Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9XWB3

Protein Details
Accession A0A4P9XWB3   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-30SILRAVPKKKTSHSKKRMRASNKGLKNREHydrophilic
NLS Segment(s)
PositionSequence
8-26PKKKTSHSKKRMRASNKGL
Subcellular Location(s) nucl 17.5, cyto_nucl 11.5, mito 5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences ESILRAVPKKKTSHSKKRMRASNKGLKNREDIVACPGCGRQKLMAHVCRHCLRDIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.81
3 0.84
4 0.88
5 0.89
6 0.86
7 0.85
8 0.83
9 0.82
10 0.8
11 0.8
12 0.74
13 0.67
14 0.63
15 0.55
16 0.47
17 0.38
18 0.3
19 0.27
20 0.25
21 0.22
22 0.19
23 0.19
24 0.19
25 0.2
26 0.21
27 0.2
28 0.22
29 0.3
30 0.38
31 0.44
32 0.47
33 0.5
34 0.56
35 0.56
36 0.55