Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9XQB6

Protein Details
Accession A0A4P9XQB6   
Localization Confidence Medium
Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
108-129EDRALAKKQKHKAPRPISRFIAHydrophilic
NLS Segment(s)
PositionSequence
113-122AKKQKHKAPR
Subcellular Location(s) nucl 17, mito 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR000305  GIY-YIG_endonuc  
IPR035901  GIY-YIG_endonuc_sf  
Gene Ontology GO:0004519  F:endonuclease activity  
Pfam View protein in Pfam  
PF01541  GIY-YIG  
PROSITE View protein in PROSITE  
PS50164  GIY_YIG  
CDD cd10455  GIY-YIG_SLX1  
Amino Acid Sequences MDSTNDSNTLEQPSPAAGIPNFYACYLLRSAKNPAKDLTYIGTTPNPIRRLRQHNGELKQGARKTTHQRPWEFVALVHGFTSSLAALQFEWAWQYPYRSRQLEAIRAEDRALAKKQKHKAPRPISRFIADARSQRVSVKLGALAAMLSAQAWSRWPLKIWV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.16
3 0.18
4 0.12
5 0.14
6 0.15
7 0.17
8 0.17
9 0.15
10 0.17
11 0.14
12 0.16
13 0.17
14 0.2
15 0.2
16 0.22
17 0.31
18 0.34
19 0.38
20 0.38
21 0.37
22 0.36
23 0.34
24 0.33
25 0.28
26 0.26
27 0.21
28 0.2
29 0.2
30 0.19
31 0.21
32 0.26
33 0.27
34 0.26
35 0.31
36 0.38
37 0.45
38 0.49
39 0.54
40 0.56
41 0.6
42 0.62
43 0.62
44 0.56
45 0.49
46 0.5
47 0.43
48 0.37
49 0.31
50 0.34
51 0.36
52 0.44
53 0.5
54 0.5
55 0.51
56 0.52
57 0.54
58 0.51
59 0.43
60 0.33
61 0.31
62 0.24
63 0.22
64 0.18
65 0.14
66 0.1
67 0.09
68 0.1
69 0.04
70 0.04
71 0.04
72 0.04
73 0.04
74 0.04
75 0.04
76 0.04
77 0.05
78 0.05
79 0.07
80 0.08
81 0.11
82 0.14
83 0.2
84 0.27
85 0.27
86 0.28
87 0.33
88 0.36
89 0.4
90 0.39
91 0.39
92 0.33
93 0.32
94 0.31
95 0.27
96 0.24
97 0.22
98 0.24
99 0.26
100 0.31
101 0.39
102 0.47
103 0.53
104 0.62
105 0.67
106 0.74
107 0.77
108 0.82
109 0.81
110 0.81
111 0.76
112 0.68
113 0.6
114 0.52
115 0.48
116 0.43
117 0.4
118 0.37
119 0.36
120 0.35
121 0.34
122 0.35
123 0.3
124 0.27
125 0.24
126 0.2
127 0.18
128 0.17
129 0.15
130 0.12
131 0.1
132 0.08
133 0.06
134 0.04
135 0.04
136 0.05
137 0.05
138 0.07
139 0.11
140 0.14
141 0.16