Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9XJ19

Protein Details
Accession A0A4P9XJ19    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
492-515ASDHEHRPPRRHSARKAVNVQAQNHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 12, extr 10, E.R. 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR003689  ZIP  
IPR045891  ZIP9  
Gene Ontology GO:0005794  C:Golgi apparatus  
GO:0016020  C:membrane  
GO:0046873  F:metal ion transmembrane transporter activity  
GO:0006829  P:zinc ion transport  
Pfam View protein in Pfam  
PF02535  Zip  
Amino Acid Sequences MWPLLRLFVLSLGMFAGSMLVGLLPFRLGLHAGNGGTSSLSAQRWTVFGSGLLVGTVLAVILPEGMETVYGHSSARHHSPAQQSAGLEAKDKVLNQVAASLASTEHADKDDRRSKRTDKQTSVGTDASEPPKSATLMRRHSEADEAEETAADQEHAAAAWHPWIGPALVLGFAFMLLVDQAATLPRRRSRQQLPLSIPRLLARGEHARNGEEETEELRRLRSASTASADTAISVPPSAPSSSSSTTLGLLVHAAADGIAMGAASAAGRDELEFVIFLAVLLHKAPAAFGLTTMLIRDGHQRAAVTRRLAAFSLAAPLAALFTYSMLALGMLVATDNGGGLASGRLDSMRRCTGLVLLFSAGTFLYVATVHALPDALAILRGDASHGHGHGHGHRPSTEEGDLALDRVFSDSEADVVVLYDRTAEHRDRDDVALRTPRTPRRFNFDSSSSSSSSDEVSPPDGDNGNGDDQGTFEPPPAIAFADNMASTPNPFASDHEHRPPRRHSARKAVNVQAQNFITLLAFSAGLFAPILFSFGHRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.08
3 0.07
4 0.04
5 0.04
6 0.04
7 0.03
8 0.04
9 0.04
10 0.04
11 0.04
12 0.04
13 0.05
14 0.06
15 0.07
16 0.08
17 0.1
18 0.14
19 0.14
20 0.14
21 0.14
22 0.13
23 0.12
24 0.12
25 0.11
26 0.11
27 0.12
28 0.13
29 0.14
30 0.14
31 0.15
32 0.17
33 0.17
34 0.13
35 0.13
36 0.14
37 0.13
38 0.12
39 0.11
40 0.09
41 0.08
42 0.07
43 0.06
44 0.04
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.04
54 0.05
55 0.07
56 0.08
57 0.09
58 0.09
59 0.1
60 0.13
61 0.17
62 0.22
63 0.24
64 0.24
65 0.31
66 0.39
67 0.44
68 0.45
69 0.43
70 0.38
71 0.37
72 0.4
73 0.33
74 0.27
75 0.22
76 0.21
77 0.2
78 0.2
79 0.21
80 0.2
81 0.21
82 0.19
83 0.2
84 0.18
85 0.16
86 0.16
87 0.13
88 0.09
89 0.09
90 0.1
91 0.08
92 0.09
93 0.1
94 0.13
95 0.14
96 0.24
97 0.32
98 0.35
99 0.39
100 0.46
101 0.52
102 0.59
103 0.69
104 0.69
105 0.67
106 0.68
107 0.71
108 0.67
109 0.64
110 0.55
111 0.44
112 0.36
113 0.35
114 0.33
115 0.27
116 0.23
117 0.2
118 0.21
119 0.21
120 0.23
121 0.26
122 0.32
123 0.39
124 0.4
125 0.42
126 0.41
127 0.41
128 0.41
129 0.34
130 0.3
131 0.23
132 0.22
133 0.19
134 0.17
135 0.16
136 0.13
137 0.12
138 0.07
139 0.05
140 0.04
141 0.04
142 0.04
143 0.05
144 0.04
145 0.05
146 0.06
147 0.06
148 0.06
149 0.06
150 0.07
151 0.06
152 0.06
153 0.06
154 0.05
155 0.06
156 0.05
157 0.05
158 0.04
159 0.04
160 0.04
161 0.03
162 0.03
163 0.02
164 0.03
165 0.02
166 0.02
167 0.03
168 0.05
169 0.07
170 0.1
171 0.15
172 0.2
173 0.26
174 0.29
175 0.38
176 0.44
177 0.53
178 0.58
179 0.62
180 0.64
181 0.68
182 0.68
183 0.61
184 0.54
185 0.44
186 0.37
187 0.28
188 0.22
189 0.17
190 0.22
191 0.21
192 0.24
193 0.25
194 0.24
195 0.24
196 0.26
197 0.22
198 0.14
199 0.13
200 0.12
201 0.13
202 0.13
203 0.13
204 0.12
205 0.12
206 0.12
207 0.12
208 0.12
209 0.12
210 0.13
211 0.15
212 0.15
213 0.15
214 0.15
215 0.14
216 0.13
217 0.11
218 0.09
219 0.07
220 0.06
221 0.05
222 0.05
223 0.07
224 0.06
225 0.07
226 0.09
227 0.13
228 0.15
229 0.16
230 0.16
231 0.15
232 0.16
233 0.16
234 0.13
235 0.09
236 0.07
237 0.06
238 0.05
239 0.04
240 0.03
241 0.03
242 0.02
243 0.02
244 0.02
245 0.02
246 0.02
247 0.02
248 0.02
249 0.02
250 0.02
251 0.02
252 0.02
253 0.02
254 0.02
255 0.02
256 0.03
257 0.03
258 0.04
259 0.04
260 0.04
261 0.04
262 0.04
263 0.04
264 0.03
265 0.03
266 0.03
267 0.04
268 0.04
269 0.04
270 0.04
271 0.04
272 0.04
273 0.05
274 0.05
275 0.05
276 0.06
277 0.06
278 0.06
279 0.06
280 0.07
281 0.06
282 0.06
283 0.12
284 0.12
285 0.13
286 0.14
287 0.14
288 0.15
289 0.2
290 0.23
291 0.18
292 0.19
293 0.19
294 0.2
295 0.2
296 0.18
297 0.14
298 0.11
299 0.12
300 0.09
301 0.08
302 0.07
303 0.06
304 0.06
305 0.05
306 0.05
307 0.03
308 0.03
309 0.03
310 0.03
311 0.04
312 0.03
313 0.03
314 0.03
315 0.03
316 0.03
317 0.02
318 0.02
319 0.02
320 0.02
321 0.02
322 0.02
323 0.02
324 0.02
325 0.02
326 0.03
327 0.03
328 0.03
329 0.04
330 0.04
331 0.04
332 0.06
333 0.07
334 0.12
335 0.14
336 0.15
337 0.15
338 0.16
339 0.18
340 0.19
341 0.19
342 0.15
343 0.13
344 0.12
345 0.11
346 0.11
347 0.08
348 0.06
349 0.05
350 0.04
351 0.04
352 0.04
353 0.05
354 0.06
355 0.07
356 0.06
357 0.06
358 0.07
359 0.06
360 0.06
361 0.06
362 0.04
363 0.05
364 0.04
365 0.05
366 0.05
367 0.05
368 0.05
369 0.05
370 0.08
371 0.1
372 0.1
373 0.11
374 0.12
375 0.14
376 0.19
377 0.26
378 0.26
379 0.27
380 0.27
381 0.29
382 0.3
383 0.32
384 0.27
385 0.19
386 0.17
387 0.18
388 0.17
389 0.15
390 0.13
391 0.09
392 0.08
393 0.09
394 0.09
395 0.06
396 0.08
397 0.07
398 0.07
399 0.08
400 0.07
401 0.06
402 0.06
403 0.07
404 0.05
405 0.05
406 0.05
407 0.06
408 0.09
409 0.13
410 0.15
411 0.19
412 0.22
413 0.25
414 0.27
415 0.3
416 0.33
417 0.31
418 0.35
419 0.39
420 0.37
421 0.4
422 0.45
423 0.51
424 0.53
425 0.59
426 0.57
427 0.57
428 0.6
429 0.6
430 0.6
431 0.55
432 0.53
433 0.51
434 0.51
435 0.43
436 0.41
437 0.36
438 0.3
439 0.27
440 0.23
441 0.19
442 0.16
443 0.18
444 0.17
445 0.17
446 0.2
447 0.18
448 0.16
449 0.17
450 0.18
451 0.17
452 0.16
453 0.15
454 0.12
455 0.13
456 0.14
457 0.15
458 0.12
459 0.11
460 0.11
461 0.11
462 0.12
463 0.12
464 0.11
465 0.09
466 0.1
467 0.1
468 0.11
469 0.11
470 0.11
471 0.11
472 0.1
473 0.11
474 0.12
475 0.12
476 0.12
477 0.13
478 0.15
479 0.22
480 0.3
481 0.36
482 0.45
483 0.54
484 0.56
485 0.64
486 0.69
487 0.71
488 0.74
489 0.77
490 0.76
491 0.77
492 0.83
493 0.85
494 0.87
495 0.84
496 0.82
497 0.79
498 0.72
499 0.68
500 0.58
501 0.49
502 0.41
503 0.32
504 0.24
505 0.17
506 0.15
507 0.09
508 0.08
509 0.07
510 0.09
511 0.08
512 0.09
513 0.09
514 0.08
515 0.08
516 0.08
517 0.1
518 0.08