Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1WDN4

Protein Details
Accession K1WDN4   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
59-79AKTLRIKKKAFVKTGKPPAAGHydrophilic
NLS Segment(s)
PositionSequence
49-87PKMVAGKSKGAKTLRIKKKAFVKTGKPPAAGERKAMRKR
Subcellular Location(s) mito 27
Family & Domain DBs
InterPro View protein in InterPro  
IPR019368  Ribosomal_S23/S29_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG mbe:MBM_06158  -  
Pfam View protein in Pfam  
PF10236  DAP3  
Amino Acid Sequences MSTSQCWKCLVARPVTAQFAPTLAVRLAAPARKFSTTAMLAAGPPTKTPKMVAGKSKGAKTLRIKKKAFVKTGKPPAAGERKAMRKRIVLSNTNALEVEDLRDLNGKLVDELLQQDAEARPNKGSLAAVVMGEDEPRMVGQVVGLNGVTVDSLRAVEAFKTTQGWGIFRRPAVLIRGESVVMARRMMEAEGKAETIRMVLDGDKGTGKSLMMLSAMATAFAKGWVVINIPEAQEVTNAMTAYAALPNTNPTLWSQNTYIANWLSQIAKANIAVLQSFTLPEELTAPITVPKGTTLFRLCELGARDPEIAWPMFEAFWSELATPGHPPVLMCLDGLSFAMQDSLYRAQDFSLIHAHDLAVIRHFVDHLSGTKKLPNGGAVLAATSRSHAPVSKSLNLAIKQAEDRQAGRNITPKDPFEKAYDARADKVLSSVEVMRLKGLTKREARGLMEYWAKSGVLRCQVDEETVAEKWALAGNGVVAEIQRAALWMRM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.57
3 0.52
4 0.43
5 0.36
6 0.29
7 0.26
8 0.19
9 0.17
10 0.12
11 0.13
12 0.12
13 0.15
14 0.2
15 0.24
16 0.25
17 0.27
18 0.31
19 0.32
20 0.33
21 0.3
22 0.33
23 0.29
24 0.29
25 0.25
26 0.23
27 0.21
28 0.23
29 0.25
30 0.17
31 0.17
32 0.23
33 0.23
34 0.23
35 0.24
36 0.3
37 0.36
38 0.43
39 0.5
40 0.51
41 0.58
42 0.63
43 0.64
44 0.63
45 0.56
46 0.58
47 0.59
48 0.63
49 0.64
50 0.69
51 0.68
52 0.68
53 0.76
54 0.77
55 0.76
56 0.74
57 0.73
58 0.73
59 0.82
60 0.8
61 0.72
62 0.64
63 0.64
64 0.64
65 0.57
66 0.53
67 0.5
68 0.55
69 0.6
70 0.65
71 0.6
72 0.55
73 0.59
74 0.62
75 0.62
76 0.58
77 0.56
78 0.58
79 0.55
80 0.5
81 0.44
82 0.35
83 0.28
84 0.22
85 0.19
86 0.12
87 0.11
88 0.1
89 0.14
90 0.14
91 0.14
92 0.15
93 0.13
94 0.12
95 0.13
96 0.13
97 0.11
98 0.13
99 0.12
100 0.1
101 0.1
102 0.12
103 0.12
104 0.17
105 0.18
106 0.18
107 0.18
108 0.18
109 0.19
110 0.18
111 0.17
112 0.12
113 0.12
114 0.11
115 0.1
116 0.1
117 0.1
118 0.09
119 0.09
120 0.08
121 0.05
122 0.04
123 0.04
124 0.05
125 0.04
126 0.04
127 0.05
128 0.08
129 0.08
130 0.08
131 0.08
132 0.07
133 0.07
134 0.07
135 0.06
136 0.04
137 0.04
138 0.03
139 0.04
140 0.04
141 0.04
142 0.05
143 0.06
144 0.07
145 0.08
146 0.08
147 0.1
148 0.1
149 0.13
150 0.14
151 0.15
152 0.17
153 0.22
154 0.24
155 0.22
156 0.24
157 0.21
158 0.22
159 0.23
160 0.23
161 0.18
162 0.17
163 0.18
164 0.16
165 0.15
166 0.14
167 0.14
168 0.11
169 0.11
170 0.1
171 0.09
172 0.1
173 0.1
174 0.11
175 0.08
176 0.09
177 0.1
178 0.1
179 0.09
180 0.09
181 0.08
182 0.07
183 0.06
184 0.05
185 0.05
186 0.05
187 0.07
188 0.07
189 0.08
190 0.09
191 0.09
192 0.09
193 0.09
194 0.08
195 0.08
196 0.08
197 0.07
198 0.06
199 0.06
200 0.06
201 0.07
202 0.07
203 0.06
204 0.06
205 0.06
206 0.06
207 0.06
208 0.05
209 0.04
210 0.04
211 0.05
212 0.05
213 0.05
214 0.07
215 0.08
216 0.08
217 0.08
218 0.08
219 0.07
220 0.07
221 0.07
222 0.07
223 0.07
224 0.07
225 0.06
226 0.06
227 0.06
228 0.06
229 0.07
230 0.06
231 0.04
232 0.05
233 0.06
234 0.07
235 0.07
236 0.07
237 0.07
238 0.11
239 0.12
240 0.14
241 0.14
242 0.19
243 0.2
244 0.19
245 0.2
246 0.16
247 0.16
248 0.14
249 0.14
250 0.09
251 0.09
252 0.11
253 0.09
254 0.1
255 0.1
256 0.1
257 0.1
258 0.09
259 0.09
260 0.07
261 0.07
262 0.06
263 0.06
264 0.06
265 0.06
266 0.05
267 0.05
268 0.06
269 0.06
270 0.07
271 0.07
272 0.07
273 0.08
274 0.08
275 0.08
276 0.07
277 0.08
278 0.09
279 0.09
280 0.13
281 0.14
282 0.15
283 0.15
284 0.17
285 0.16
286 0.17
287 0.19
288 0.19
289 0.18
290 0.18
291 0.18
292 0.16
293 0.17
294 0.16
295 0.14
296 0.1
297 0.09
298 0.08
299 0.08
300 0.08
301 0.09
302 0.07
303 0.08
304 0.09
305 0.09
306 0.1
307 0.11
308 0.12
309 0.11
310 0.11
311 0.11
312 0.1
313 0.09
314 0.09
315 0.11
316 0.11
317 0.09
318 0.09
319 0.09
320 0.09
321 0.09
322 0.07
323 0.05
324 0.04
325 0.05
326 0.04
327 0.05
328 0.08
329 0.11
330 0.11
331 0.12
332 0.12
333 0.12
334 0.15
335 0.15
336 0.15
337 0.17
338 0.16
339 0.16
340 0.17
341 0.16
342 0.16
343 0.17
344 0.15
345 0.11
346 0.11
347 0.11
348 0.11
349 0.11
350 0.08
351 0.08
352 0.09
353 0.12
354 0.15
355 0.17
356 0.18
357 0.21
358 0.23
359 0.23
360 0.23
361 0.21
362 0.19
363 0.17
364 0.17
365 0.14
366 0.13
367 0.11
368 0.11
369 0.09
370 0.09
371 0.09
372 0.09
373 0.1
374 0.12
375 0.16
376 0.23
377 0.29
378 0.32
379 0.33
380 0.35
381 0.4
382 0.38
383 0.37
384 0.31
385 0.28
386 0.26
387 0.28
388 0.31
389 0.28
390 0.29
391 0.32
392 0.36
393 0.36
394 0.35
395 0.39
396 0.37
397 0.4
398 0.43
399 0.4
400 0.4
401 0.41
402 0.41
403 0.38
404 0.41
405 0.37
406 0.39
407 0.44
408 0.41
409 0.4
410 0.4
411 0.36
412 0.3
413 0.3
414 0.24
415 0.16
416 0.17
417 0.16
418 0.19
419 0.21
420 0.21
421 0.2
422 0.2
423 0.22
424 0.24
425 0.27
426 0.3
427 0.34
428 0.38
429 0.43
430 0.47
431 0.48
432 0.48
433 0.45
434 0.42
435 0.43
436 0.39
437 0.34
438 0.3
439 0.28
440 0.24
441 0.26
442 0.27
443 0.29
444 0.3
445 0.29
446 0.33
447 0.34
448 0.34
449 0.32
450 0.27
451 0.21
452 0.2
453 0.2
454 0.15
455 0.14
456 0.14
457 0.15
458 0.13
459 0.09
460 0.1
461 0.09
462 0.1
463 0.1
464 0.09
465 0.06
466 0.07
467 0.07
468 0.07
469 0.06
470 0.07