Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9XM15

Protein Details
Accession A0A4P9XM15    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
26-62SKIFRFCRSKCHKNFKMKRNPRKIRWTKAFRKAAGKEHydrophilic
NLS Segment(s)
PositionSequence
40-60FKMKRNPRKIRWTKAFRKAAG
Subcellular Location(s) mito 18, nucl 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR038630  L24e/L24_sf  
IPR000988  Ribosomal_L24e-rel  
IPR023442  Ribosomal_L24e_CS  
IPR011017  TRASH_dom  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF01246  Ribosomal_L24e  
PROSITE View protein in PROSITE  
PS01073  RIBOSOMAL_L24E  
CDD cd00472  Ribosomal_L24e_L24  
Amino Acid Sequences MRLEKCYFCSSTVYPGHGITFVRNDSKIFRFCRSKCHKNFKMKRNPRKIRWTKAFRKAAGKEMTIVGVLRAP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.28
3 0.27
4 0.24
5 0.23
6 0.16
7 0.17
8 0.16
9 0.17
10 0.17
11 0.18
12 0.2
13 0.24
14 0.28
15 0.28
16 0.32
17 0.38
18 0.38
19 0.48
20 0.53
21 0.59
22 0.62
23 0.7
24 0.72
25 0.75
26 0.84
27 0.84
28 0.86
29 0.87
30 0.88
31 0.89
32 0.91
33 0.88
34 0.9
35 0.89
36 0.88
37 0.88
38 0.88
39 0.86
40 0.87
41 0.87
42 0.8
43 0.8
44 0.73
45 0.71
46 0.66
47 0.56
48 0.48
49 0.41
50 0.37
51 0.28
52 0.25