Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9XLX4

Protein Details
Accession A0A4P9XLX4    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
52-71PLRVCVKRDRCQQEKRKTINHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15.5, cyto_nucl 12, cyto 5.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR003958  CBFA_NFYB_domain  
IPR009072  Histone-fold  
IPR027113  Transc_fact_NFYB/HAP3  
Gene Ontology GO:0016602  C:CCAAT-binding factor complex  
GO:0001228  F:DNA-binding transcription activator activity, RNA polymerase II-specific  
GO:0046982  F:protein heterodimerization activity  
Pfam View protein in Pfam  
PF00808  CBFD_NFYB_HMF  
Amino Acid Sequences EVKEQDRFLPIANVARIMKRGLPENAKIAKEAKETIQECVSEFISFITSEYPLRVCVKRDRCQQEKRKTINGEDILWAMQTLGFDNYADALKLYLAKYREVN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.26
3 0.26
4 0.24
5 0.24
6 0.21
7 0.25
8 0.27
9 0.31
10 0.32
11 0.38
12 0.41
13 0.39
14 0.39
15 0.36
16 0.33
17 0.3
18 0.29
19 0.24
20 0.27
21 0.27
22 0.28
23 0.27
24 0.24
25 0.22
26 0.23
27 0.21
28 0.13
29 0.12
30 0.09
31 0.08
32 0.08
33 0.08
34 0.06
35 0.06
36 0.07
37 0.07
38 0.07
39 0.08
40 0.11
41 0.13
42 0.15
43 0.23
44 0.31
45 0.39
46 0.48
47 0.55
48 0.6
49 0.69
50 0.77
51 0.78
52 0.8
53 0.78
54 0.77
55 0.72
56 0.67
57 0.66
58 0.58
59 0.49
60 0.4
61 0.35
62 0.26
63 0.23
64 0.19
65 0.1
66 0.08
67 0.07
68 0.07
69 0.07
70 0.07
71 0.07
72 0.07
73 0.09
74 0.08
75 0.08
76 0.07
77 0.07
78 0.07
79 0.1
80 0.11
81 0.15
82 0.16