Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E2LV15

Protein Details
Accession E2LV15   
Localization Confidence Medium
Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MGKRKKSSRKPAPARQKVPLDTHydrophilic
NLS Segment(s)
PositionSequence
3-15KRKKSSRKPAPAR
Subcellular Location(s) mito 15, nucl 10.5, cyto_nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
KEGG mpr:MPER_11018  -  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKKSSRKPAPARQKVPLDTTFTCLFCHHDNSVTVRIDRKEGIAQLVCRTCDQRYQSKVNHLTEPIDIYSEWIDAADEAQRVGETSSSRRPAASSSRAVASRRSPSVDSDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.86
3 0.83
4 0.75
5 0.71
6 0.64
7 0.59
8 0.49
9 0.48
10 0.42
11 0.34
12 0.32
13 0.26
14 0.26
15 0.22
16 0.25
17 0.21
18 0.21
19 0.22
20 0.25
21 0.3
22 0.29
23 0.27
24 0.27
25 0.27
26 0.26
27 0.25
28 0.22
29 0.19
30 0.18
31 0.2
32 0.19
33 0.19
34 0.2
35 0.22
36 0.2
37 0.19
38 0.2
39 0.17
40 0.2
41 0.23
42 0.26
43 0.3
44 0.35
45 0.37
46 0.44
47 0.5
48 0.47
49 0.45
50 0.39
51 0.35
52 0.29
53 0.28
54 0.2
55 0.14
56 0.11
57 0.1
58 0.1
59 0.08
60 0.08
61 0.06
62 0.06
63 0.05
64 0.06
65 0.06
66 0.06
67 0.06
68 0.06
69 0.06
70 0.06
71 0.07
72 0.09
73 0.09
74 0.13
75 0.21
76 0.25
77 0.25
78 0.25
79 0.26
80 0.29
81 0.35
82 0.37
83 0.33
84 0.32
85 0.37
86 0.4
87 0.41
88 0.41
89 0.4
90 0.41
91 0.4
92 0.42
93 0.39
94 0.39