Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9XXJ7

Protein Details
Accession A0A4P9XXJ7    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
5-51TSLNRTPIVKKRTKRFARHQSDRFLRVDASWRKPKGIDNRVRRRFKGHydrophilic
NLS Segment(s)
PositionSequence
14-23KKRTKRFARH
34-49SWRKPKGIDNRVRRRF
Subcellular Location(s) mito 14, mito_nucl 11.5, nucl 7, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MTTVTSLNRTPIVKKRTKRFARHQSDRFLRVDASWRKPKGIDNRVRRRFKGQIAMPNIGYGSNKKTRHLMPNGFKKFLVSNVKELDLLMMQNRTYAAEIAHNVSSRKRIQIVERAAQLNIKVTNAKARVRTEEN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.64
3 0.71
4 0.79
5 0.83
6 0.85
7 0.87
8 0.88
9 0.9
10 0.87
11 0.86
12 0.83
13 0.78
14 0.68
15 0.59
16 0.49
17 0.39
18 0.42
19 0.4
20 0.41
21 0.45
22 0.45
23 0.45
24 0.46
25 0.52
26 0.53
27 0.55
28 0.56
29 0.59
30 0.69
31 0.77
32 0.81
33 0.76
34 0.73
35 0.69
36 0.65
37 0.63
38 0.57
39 0.55
40 0.54
41 0.54
42 0.46
43 0.4
44 0.34
45 0.26
46 0.21
47 0.14
48 0.14
49 0.19
50 0.2
51 0.21
52 0.25
53 0.28
54 0.36
55 0.41
56 0.45
57 0.45
58 0.55
59 0.58
60 0.55
61 0.51
62 0.45
63 0.38
64 0.37
65 0.37
66 0.28
67 0.29
68 0.29
69 0.3
70 0.29
71 0.28
72 0.22
73 0.14
74 0.12
75 0.09
76 0.09
77 0.08
78 0.09
79 0.09
80 0.09
81 0.09
82 0.09
83 0.08
84 0.1
85 0.11
86 0.13
87 0.15
88 0.16
89 0.16
90 0.18
91 0.23
92 0.23
93 0.25
94 0.27
95 0.28
96 0.33
97 0.42
98 0.47
99 0.47
100 0.5
101 0.48
102 0.44
103 0.42
104 0.37
105 0.32
106 0.26
107 0.22
108 0.19
109 0.18
110 0.27
111 0.3
112 0.35
113 0.37
114 0.4