Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9XPW1

Protein Details
Accession A0A4P9XPW1    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
132-163AKLSRLDEKLQRKRDKAKVKIMKKQLKAAKKDBasic
NLS Segment(s)
PositionSequence
140-163KLQRKRDKAKVKIMKKQLKAAKKD
Subcellular Location(s) mito 11.5mito_nucl 11.5, nucl 10.5, cyto 3
Family & Domain DBs
Amino Acid Sequences MGKHKKEKYGKGAGSLLDSYLSARDSHGGAPPPFNASDDVVPLPESMRASTLLQQIGQERYWSPEQIAGDTSILDMHRLYTVSELRVLSDDSWKEIPLVPLAKDLLRAAIRIGAPAVAATPAAVRDREVQDAKLSRLDEKLQRKRDKAKVKIMKKQLKAAKKD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.41
3 0.32
4 0.22
5 0.2
6 0.15
7 0.12
8 0.12
9 0.09
10 0.09
11 0.1
12 0.11
13 0.12
14 0.16
15 0.21
16 0.22
17 0.23
18 0.24
19 0.25
20 0.24
21 0.24
22 0.21
23 0.17
24 0.16
25 0.16
26 0.16
27 0.13
28 0.13
29 0.12
30 0.11
31 0.11
32 0.11
33 0.09
34 0.1
35 0.11
36 0.12
37 0.16
38 0.19
39 0.18
40 0.17
41 0.18
42 0.2
43 0.2
44 0.19
45 0.16
46 0.13
47 0.16
48 0.18
49 0.17
50 0.15
51 0.15
52 0.15
53 0.15
54 0.15
55 0.12
56 0.11
57 0.1
58 0.09
59 0.08
60 0.07
61 0.07
62 0.06
63 0.05
64 0.06
65 0.06
66 0.06
67 0.08
68 0.09
69 0.09
70 0.11
71 0.1
72 0.1
73 0.11
74 0.11
75 0.09
76 0.13
77 0.12
78 0.13
79 0.13
80 0.13
81 0.13
82 0.14
83 0.14
84 0.13
85 0.15
86 0.13
87 0.14
88 0.14
89 0.14
90 0.13
91 0.13
92 0.14
93 0.12
94 0.12
95 0.11
96 0.14
97 0.14
98 0.13
99 0.13
100 0.09
101 0.08
102 0.08
103 0.08
104 0.04
105 0.04
106 0.04
107 0.04
108 0.06
109 0.07
110 0.08
111 0.09
112 0.14
113 0.17
114 0.23
115 0.24
116 0.24
117 0.29
118 0.33
119 0.33
120 0.32
121 0.31
122 0.26
123 0.28
124 0.33
125 0.35
126 0.42
127 0.51
128 0.57
129 0.64
130 0.7
131 0.77
132 0.81
133 0.84
134 0.82
135 0.83
136 0.84
137 0.85
138 0.87
139 0.88
140 0.88
141 0.82
142 0.83
143 0.81