Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1WRH9

Protein Details
Accession K1WRH9    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MPFKSPRNQLKRLSAKSHKKKLFSHydrophilic
NLS Segment(s)
PositionSequence
12-21RLSAKSHKKK
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
KEGG mbe:MBM_02212  -  
Amino Acid Sequences MPFKSPRNQLKRLSAKSHKKKLFSVFKKGFAIILDVKAKTYGAKSFSKGKSRRANDLIDADKLKDFKESLRSIELSFNDFDLSVKIILKSAKSTRKPRFTGQIDDLKASSSQPESLNRAFDKAIEALADLLKDEDNLTSGFRLYSGLADPPSAKFTLINDATNKRKNDTRSFTLKDTAASTSSSNASLAKRRRPSQSEENERVEDVSTEGDHKEAAEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.83
3 0.86
4 0.88
5 0.85
6 0.79
7 0.78
8 0.79
9 0.79
10 0.76
11 0.76
12 0.71
13 0.7
14 0.68
15 0.61
16 0.52
17 0.41
18 0.39
19 0.3
20 0.29
21 0.27
22 0.24
23 0.24
24 0.23
25 0.23
26 0.19
27 0.19
28 0.18
29 0.19
30 0.23
31 0.25
32 0.34
33 0.41
34 0.49
35 0.51
36 0.57
37 0.62
38 0.63
39 0.69
40 0.65
41 0.62
42 0.55
43 0.57
44 0.5
45 0.44
46 0.4
47 0.32
48 0.29
49 0.26
50 0.22
51 0.18
52 0.16
53 0.15
54 0.23
55 0.23
56 0.24
57 0.27
58 0.28
59 0.27
60 0.3
61 0.28
62 0.22
63 0.21
64 0.18
65 0.15
66 0.14
67 0.13
68 0.09
69 0.09
70 0.07
71 0.08
72 0.07
73 0.09
74 0.1
75 0.1
76 0.14
77 0.2
78 0.28
79 0.35
80 0.45
81 0.52
82 0.6
83 0.63
84 0.63
85 0.66
86 0.61
87 0.59
88 0.54
89 0.53
90 0.45
91 0.42
92 0.38
93 0.29
94 0.25
95 0.19
96 0.15
97 0.08
98 0.09
99 0.1
100 0.13
101 0.16
102 0.17
103 0.2
104 0.19
105 0.2
106 0.18
107 0.16
108 0.16
109 0.12
110 0.11
111 0.08
112 0.08
113 0.07
114 0.07
115 0.07
116 0.05
117 0.05
118 0.05
119 0.05
120 0.05
121 0.04
122 0.05
123 0.06
124 0.06
125 0.06
126 0.06
127 0.06
128 0.06
129 0.07
130 0.06
131 0.07
132 0.07
133 0.09
134 0.09
135 0.1
136 0.11
137 0.11
138 0.13
139 0.12
140 0.11
141 0.1
142 0.11
143 0.19
144 0.2
145 0.22
146 0.24
147 0.29
148 0.36
149 0.42
150 0.43
151 0.38
152 0.42
153 0.46
154 0.51
155 0.54
156 0.54
157 0.56
158 0.59
159 0.59
160 0.58
161 0.52
162 0.43
163 0.37
164 0.32
165 0.24
166 0.21
167 0.19
168 0.16
169 0.17
170 0.16
171 0.14
172 0.15
173 0.17
174 0.25
175 0.31
176 0.39
177 0.46
178 0.51
179 0.6
180 0.63
181 0.68
182 0.7
183 0.74
184 0.75
185 0.73
186 0.74
187 0.66
188 0.61
189 0.54
190 0.44
191 0.33
192 0.24
193 0.19
194 0.14
195 0.14
196 0.14
197 0.13
198 0.12