Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3G2S4H8

Protein Details
Accession A0A3G2S4H8    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
210-231QFEVQHRRKRGRPPAKRLSLQEHydrophilic
NLS Segment(s)
PositionSequence
216-226RRKRGRPPAKR
Subcellular Location(s) nucl 17.5, cyto_nucl 10, mito 6
Family & Domain DBs
Amino Acid Sequences MSAALTTLCQGDRRVRDKARMYIDRVKIWETQGNARSTQDISVSVPAVCVWLAAESLGVDSIQRRDLQRSSGLAPARFDRAENLLRQVIATFDRTRHERVRTIPAARPERPNTRRRSSSQGELIQRAKEIQESAQLGHGAVEAIPPPSSSEAFDAAMKQPPQTKVPKRIREESPNTPLSATDSAPDRPKADPSHIRLLALGVPSYREGLQFEVQHRRKRGRPPAKRLSLQEMNDKQFLDSLWSNSPLPSHLRIAGMPLRYVQKAHLDAHDSHWIRPLPRPLSIYSGNPSGTRLRPSHIWNKWVSQTLCP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.5
3 0.58
4 0.63
5 0.68
6 0.7
7 0.68
8 0.7
9 0.71
10 0.71
11 0.67
12 0.62
13 0.56
14 0.49
15 0.47
16 0.43
17 0.37
18 0.4
19 0.41
20 0.41
21 0.39
22 0.37
23 0.35
24 0.32
25 0.3
26 0.22
27 0.18
28 0.17
29 0.18
30 0.18
31 0.15
32 0.14
33 0.13
34 0.12
35 0.1
36 0.08
37 0.06
38 0.05
39 0.06
40 0.05
41 0.05
42 0.05
43 0.05
44 0.05
45 0.05
46 0.05
47 0.07
48 0.09
49 0.11
50 0.14
51 0.15
52 0.21
53 0.23
54 0.26
55 0.28
56 0.3
57 0.3
58 0.32
59 0.34
60 0.3
61 0.3
62 0.28
63 0.28
64 0.26
65 0.24
66 0.2
67 0.22
68 0.25
69 0.24
70 0.26
71 0.23
72 0.23
73 0.22
74 0.2
75 0.16
76 0.14
77 0.16
78 0.14
79 0.15
80 0.19
81 0.22
82 0.27
83 0.31
84 0.34
85 0.35
86 0.38
87 0.46
88 0.48
89 0.49
90 0.47
91 0.51
92 0.53
93 0.52
94 0.54
95 0.51
96 0.56
97 0.59
98 0.63
99 0.62
100 0.63
101 0.66
102 0.63
103 0.66
104 0.6
105 0.59
106 0.58
107 0.57
108 0.52
109 0.51
110 0.49
111 0.4
112 0.36
113 0.3
114 0.23
115 0.17
116 0.15
117 0.1
118 0.13
119 0.13
120 0.13
121 0.14
122 0.14
123 0.13
124 0.12
125 0.11
126 0.07
127 0.06
128 0.06
129 0.04
130 0.05
131 0.05
132 0.05
133 0.05
134 0.07
135 0.07
136 0.08
137 0.08
138 0.09
139 0.1
140 0.1
141 0.1
142 0.1
143 0.14
144 0.13
145 0.13
146 0.16
147 0.18
148 0.22
149 0.3
150 0.36
151 0.43
152 0.53
153 0.6
154 0.61
155 0.66
156 0.68
157 0.68
158 0.69
159 0.65
160 0.62
161 0.55
162 0.5
163 0.42
164 0.36
165 0.3
166 0.25
167 0.18
168 0.13
169 0.13
170 0.15
171 0.18
172 0.2
173 0.18
174 0.17
175 0.22
176 0.23
177 0.28
178 0.33
179 0.35
180 0.43
181 0.42
182 0.41
183 0.37
184 0.35
185 0.3
186 0.23
187 0.18
188 0.09
189 0.09
190 0.1
191 0.11
192 0.1
193 0.09
194 0.09
195 0.12
196 0.15
197 0.18
198 0.22
199 0.32
200 0.37
201 0.43
202 0.48
203 0.51
204 0.54
205 0.61
206 0.69
207 0.69
208 0.74
209 0.77
210 0.83
211 0.85
212 0.84
213 0.78
214 0.75
215 0.72
216 0.64
217 0.64
218 0.59
219 0.54
220 0.51
221 0.47
222 0.38
223 0.31
224 0.28
225 0.24
226 0.19
227 0.19
228 0.19
229 0.22
230 0.22
231 0.21
232 0.22
233 0.18
234 0.21
235 0.21
236 0.21
237 0.2
238 0.21
239 0.21
240 0.26
241 0.28
242 0.25
243 0.23
244 0.23
245 0.25
246 0.24
247 0.25
248 0.22
249 0.25
250 0.28
251 0.3
252 0.31
253 0.32
254 0.32
255 0.37
256 0.44
257 0.38
258 0.34
259 0.39
260 0.38
261 0.35
262 0.41
263 0.45
264 0.39
265 0.43
266 0.45
267 0.4
268 0.44
269 0.46
270 0.43
271 0.37
272 0.38
273 0.34
274 0.31
275 0.32
276 0.32
277 0.32
278 0.34
279 0.32
280 0.33
281 0.38
282 0.45
283 0.53
284 0.53
285 0.56
286 0.54
287 0.58
288 0.59
289 0.63