Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3G2RZV4

Protein Details
Accession A0A3G2RZV4   
Localization Confidence Medium
Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
3-28AATIPIVKKRTKKFARHQSDRFKRVSHydrophilic
NLS Segment(s)
PositionSequence
10-21KKRTKKFARHQS
23-23R
Subcellular Location(s) mito 13.5, mito_nucl 10.5, cyto 7, nucl 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MPAATIPIVKKRTKKFARHQSDRFKRVSPNWRKPTGIDNCVRRRFKGTISMPKIGYGSNKKTRHIMPNGYRRFVVANVNDMDLLLMHNNTFAAEIAHNVSSKKRIQILEKAKVLGVRVTNANARVRAQEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.76
3 0.81
4 0.87
5 0.88
6 0.9
7 0.9
8 0.91
9 0.87
10 0.79
11 0.72
12 0.68
13 0.67
14 0.69
15 0.68
16 0.69
17 0.71
18 0.72
19 0.69
20 0.63
21 0.64
22 0.61
23 0.58
24 0.53
25 0.54
26 0.59
27 0.67
28 0.67
29 0.58
30 0.56
31 0.5
32 0.47
33 0.48
34 0.46
35 0.48
36 0.51
37 0.54
38 0.48
39 0.47
40 0.44
41 0.34
42 0.32
43 0.28
44 0.3
45 0.36
46 0.38
47 0.38
48 0.42
49 0.45
50 0.47
51 0.46
52 0.47
53 0.46
54 0.54
55 0.56
56 0.53
57 0.49
58 0.42
59 0.37
60 0.3
61 0.27
62 0.18
63 0.19
64 0.18
65 0.19
66 0.18
67 0.17
68 0.15
69 0.09
70 0.09
71 0.05
72 0.05
73 0.04
74 0.05
75 0.05
76 0.05
77 0.05
78 0.05
79 0.06
80 0.06
81 0.07
82 0.09
83 0.1
84 0.11
85 0.11
86 0.13
87 0.17
88 0.2
89 0.23
90 0.27
91 0.3
92 0.35
93 0.45
94 0.52
95 0.56
96 0.56
97 0.53
98 0.48
99 0.46
100 0.42
101 0.36
102 0.28
103 0.22
104 0.22
105 0.24
106 0.27
107 0.3
108 0.33
109 0.31
110 0.31