Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3G2S6G8

Protein Details
Accession A0A3G2S6G8   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
88-110RESLRQKEKSSSKPLPKPDPKSEHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 14, E.R. 6, mito 4, vacu 2, cyto_mito 2, mito_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013945  Pkr1  
Gene Ontology GO:0016020  C:membrane  
GO:0070072  P:vacuolar proton-transporting V-type ATPase complex assembly  
Pfam View protein in Pfam  
PF08636  Pkr1  
Amino Acid Sequences MVGDSRAEPSRIMPGSFESWLEKVLDSIFQEGVNSATLNFMNYTFYALFAVLTTLFLGSGLNLHVLALLLLAIVLCLATNWFVSELYRESLRQKEKSSSKPLPKPDPKSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.25
3 0.26
4 0.25
5 0.2
6 0.18
7 0.19
8 0.19
9 0.15
10 0.12
11 0.12
12 0.13
13 0.11
14 0.13
15 0.12
16 0.11
17 0.11
18 0.1
19 0.11
20 0.09
21 0.08
22 0.06
23 0.07
24 0.07
25 0.07
26 0.08
27 0.07
28 0.08
29 0.08
30 0.1
31 0.09
32 0.09
33 0.09
34 0.08
35 0.08
36 0.06
37 0.07
38 0.04
39 0.04
40 0.04
41 0.04
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.03
54 0.03
55 0.03
56 0.02
57 0.02
58 0.02
59 0.02
60 0.02
61 0.02
62 0.02
63 0.02
64 0.02
65 0.03
66 0.03
67 0.04
68 0.05
69 0.06
70 0.06
71 0.09
72 0.11
73 0.13
74 0.14
75 0.15
76 0.19
77 0.27
78 0.34
79 0.37
80 0.39
81 0.47
82 0.54
83 0.61
84 0.67
85 0.69
86 0.72
87 0.75
88 0.8
89 0.82
90 0.84