Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1WKN4

Protein Details
Accession K1WKN4   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
240-260LTIARKKEEQRRSARFKRILFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR027521  Usb1  
Gene Ontology GO:0005634  C:nucleus  
GO:0016829  F:lyase activity  
GO:1990838  F:poly(U)-specific exoribonuclease activity, producing 3' uridine cyclic phosphate ends  
GO:0034477  P:U6 snRNA 3'-end processing  
KEGG mbe:MBM_03987  -  
Pfam View protein in Pfam  
PF09749  HVSL  
Amino Acid Sequences MALVDYPSSDEEESEVNPTPTLTPTLTPTPRPVKDLPDLNLKRKRVETVLDLPPLPSKFHDLYASTTRRSTRDEPSLHEGRKRLIPHIEGNWPTHLYIECMLSTSCTTMGKDLADSIEALQERDSREPKSKVHSLVTSDIGVPLPLHVSLSRSLGFLAPQKDDFVDSLRRAVKESGIRPFNLSFNGLKWVANFEGTRWFLVLRIPRPEEDGLNKLLHVCNSTVKQYGQPPLYPKPPSEPLTIARKKEEQRRSARFKRILFDTPSRKTDWTQMQDATDAFHVSLAWTLQSPSDEILELTEMATKDHLDGIQAIQLRVEEIKCKVGNVVTSMPLPISISDLQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.18
3 0.16
4 0.16
5 0.17
6 0.17
7 0.16
8 0.19
9 0.17
10 0.16
11 0.2
12 0.29
13 0.32
14 0.34
15 0.4
16 0.46
17 0.47
18 0.51
19 0.5
20 0.47
21 0.51
22 0.55
23 0.51
24 0.53
25 0.56
26 0.6
27 0.65
28 0.61
29 0.59
30 0.55
31 0.56
32 0.49
33 0.48
34 0.46
35 0.46
36 0.5
37 0.47
38 0.44
39 0.4
40 0.41
41 0.37
42 0.32
43 0.25
44 0.24
45 0.23
46 0.25
47 0.28
48 0.25
49 0.29
50 0.37
51 0.39
52 0.35
53 0.37
54 0.37
55 0.36
56 0.41
57 0.41
58 0.39
59 0.45
60 0.46
61 0.48
62 0.53
63 0.58
64 0.54
65 0.54
66 0.47
67 0.42
68 0.45
69 0.41
70 0.38
71 0.36
72 0.37
73 0.38
74 0.4
75 0.44
76 0.41
77 0.41
78 0.39
79 0.34
80 0.3
81 0.26
82 0.22
83 0.16
84 0.15
85 0.14
86 0.11
87 0.12
88 0.11
89 0.11
90 0.11
91 0.1
92 0.1
93 0.09
94 0.1
95 0.1
96 0.11
97 0.1
98 0.1
99 0.1
100 0.09
101 0.08
102 0.08
103 0.08
104 0.1
105 0.09
106 0.09
107 0.1
108 0.12
109 0.13
110 0.18
111 0.2
112 0.2
113 0.28
114 0.31
115 0.32
116 0.37
117 0.41
118 0.39
119 0.4
120 0.39
121 0.35
122 0.35
123 0.34
124 0.27
125 0.22
126 0.19
127 0.15
128 0.13
129 0.09
130 0.07
131 0.06
132 0.05
133 0.05
134 0.05
135 0.07
136 0.08
137 0.1
138 0.1
139 0.09
140 0.1
141 0.1
142 0.11
143 0.13
144 0.14
145 0.13
146 0.13
147 0.14
148 0.13
149 0.14
150 0.13
151 0.12
152 0.14
153 0.13
154 0.17
155 0.19
156 0.19
157 0.2
158 0.2
159 0.21
160 0.23
161 0.25
162 0.28
163 0.27
164 0.27
165 0.28
166 0.29
167 0.26
168 0.21
169 0.2
170 0.14
171 0.13
172 0.16
173 0.14
174 0.13
175 0.13
176 0.14
177 0.12
178 0.14
179 0.13
180 0.1
181 0.16
182 0.17
183 0.17
184 0.14
185 0.14
186 0.12
187 0.16
188 0.21
189 0.18
190 0.23
191 0.25
192 0.25
193 0.28
194 0.29
195 0.27
196 0.26
197 0.25
198 0.22
199 0.2
200 0.2
201 0.18
202 0.18
203 0.16
204 0.14
205 0.12
206 0.14
207 0.15
208 0.18
209 0.19
210 0.18
211 0.22
212 0.25
213 0.3
214 0.28
215 0.29
216 0.32
217 0.35
218 0.41
219 0.39
220 0.36
221 0.36
222 0.4
223 0.41
224 0.39
225 0.37
226 0.36
227 0.45
228 0.49
229 0.45
230 0.42
231 0.46
232 0.49
233 0.56
234 0.6
235 0.59
236 0.64
237 0.71
238 0.77
239 0.79
240 0.83
241 0.81
242 0.75
243 0.71
244 0.67
245 0.64
246 0.6
247 0.61
248 0.6
249 0.58
250 0.57
251 0.54
252 0.5
253 0.45
254 0.48
255 0.48
256 0.44
257 0.43
258 0.43
259 0.4
260 0.4
261 0.38
262 0.31
263 0.22
264 0.17
265 0.12
266 0.1
267 0.09
268 0.08
269 0.09
270 0.08
271 0.07
272 0.07
273 0.08
274 0.09
275 0.1
276 0.1
277 0.1
278 0.11
279 0.11
280 0.1
281 0.11
282 0.11
283 0.1
284 0.09
285 0.12
286 0.11
287 0.11
288 0.12
289 0.11
290 0.11
291 0.13
292 0.13
293 0.1
294 0.12
295 0.12
296 0.16
297 0.17
298 0.17
299 0.15
300 0.15
301 0.15
302 0.17
303 0.17
304 0.17
305 0.18
306 0.26
307 0.26
308 0.26
309 0.28
310 0.28
311 0.29
312 0.3
313 0.3
314 0.25
315 0.25
316 0.25
317 0.23
318 0.2
319 0.18
320 0.14