Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3G2S216

Protein Details
Accession A0A3G2S216   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
81-115STSHPHDSSKDRWRRKMRKKGARHGSGKKRRQAAWBasic
NLS Segment(s)
PositionSequence
90-113KDRWRRKMRKKGARHGSGKKRRQA
Subcellular Location(s) nucl 19.5, cyto_nucl 11, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSLRSHSKLAARNAKRYTEGTDYAVTAAARLQQVSDRLKQRLQAPKLSETNKDEEEKMDDAHDNDKEADMQVEAPAKISTSHPHDSSKDRWRRKMRKKGARHGSGKKRRQAAW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.65
2 0.67
3 0.64
4 0.59
5 0.54
6 0.5
7 0.45
8 0.42
9 0.36
10 0.33
11 0.29
12 0.26
13 0.25
14 0.19
15 0.13
16 0.11
17 0.11
18 0.1
19 0.1
20 0.1
21 0.1
22 0.16
23 0.2
24 0.25
25 0.28
26 0.3
27 0.32
28 0.35
29 0.4
30 0.45
31 0.44
32 0.44
33 0.43
34 0.46
35 0.5
36 0.49
37 0.46
38 0.39
39 0.39
40 0.35
41 0.33
42 0.27
43 0.22
44 0.23
45 0.2
46 0.17
47 0.14
48 0.12
49 0.12
50 0.15
51 0.14
52 0.12
53 0.11
54 0.11
55 0.1
56 0.1
57 0.09
58 0.07
59 0.07
60 0.07
61 0.09
62 0.09
63 0.1
64 0.09
65 0.09
66 0.1
67 0.11
68 0.15
69 0.19
70 0.23
71 0.24
72 0.28
73 0.31
74 0.35
75 0.42
76 0.48
77 0.52
78 0.57
79 0.65
80 0.73
81 0.81
82 0.86
83 0.9
84 0.9
85 0.91
86 0.93
87 0.94
88 0.93
89 0.92
90 0.91
91 0.9
92 0.91
93 0.91
94 0.89
95 0.86