Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1X5W9

Protein Details
Accession K1X5W9    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
6-31GLIAAPPQRQNRRRERPGSRSRRILTHydrophilic
NLS Segment(s)
PositionSequence
16-29NRRRERPGSRSRRI
Subcellular Location(s) mito 9, nucl 6, cyto 6, cyto_nucl 6
Family & Domain DBs
KEGG mbe:MBM_01209  -  
Amino Acid Sequences MVATDGLIAAPPQRQNRRRERPGSRSRRILTRKANLQYELHEGLLDAHDASIQLPSDKTRSSPLLRQSFDQSWQRWQARRTEEKALAELDKRWLEQEQLVMFGGELGDDVSLIPDTAMLGVVVSLFGDIDYIDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.54
3 0.65
4 0.74
5 0.8
6 0.84
7 0.85
8 0.85
9 0.89
10 0.9
11 0.87
12 0.86
13 0.8
14 0.8
15 0.76
16 0.75
17 0.73
18 0.71
19 0.72
20 0.69
21 0.69
22 0.61
23 0.56
24 0.49
25 0.45
26 0.37
27 0.29
28 0.22
29 0.18
30 0.16
31 0.15
32 0.12
33 0.07
34 0.05
35 0.05
36 0.05
37 0.05
38 0.05
39 0.05
40 0.05
41 0.06
42 0.07
43 0.09
44 0.09
45 0.1
46 0.13
47 0.17
48 0.19
49 0.24
50 0.31
51 0.37
52 0.37
53 0.38
54 0.39
55 0.36
56 0.38
57 0.39
58 0.31
59 0.29
60 0.36
61 0.39
62 0.38
63 0.39
64 0.41
65 0.44
66 0.5
67 0.49
68 0.48
69 0.48
70 0.45
71 0.45
72 0.39
73 0.33
74 0.27
75 0.24
76 0.22
77 0.19
78 0.18
79 0.18
80 0.17
81 0.17
82 0.17
83 0.2
84 0.15
85 0.16
86 0.16
87 0.14
88 0.13
89 0.11
90 0.1
91 0.05
92 0.05
93 0.04
94 0.03
95 0.03
96 0.03
97 0.04
98 0.04
99 0.04
100 0.04
101 0.04
102 0.04
103 0.05
104 0.05
105 0.04
106 0.04
107 0.04
108 0.04
109 0.04
110 0.04
111 0.03
112 0.03
113 0.03
114 0.03