Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A3G2S2T8

Protein Details
Accession A0A3G2S2T8   
Localization Confidence Low
Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
20-41KNPWRLSSTRKMRVRQRLRDVDHydrophilic
82-107DKNYRKSVHKVPKFTRKSLRVNPRGFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 19.5, mito_nucl 13.333, nucl 6, cyto_nucl 3.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MSFLGAFRPSSPTFGGLLWKNPWRLSSTRKMRVRQRLRDVDSVIETIKASGVQCRALDRDLTLPKEPDMHSRDKYTVFSPHDKNYRKSVHKVPKFTRKSLRVNPRGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.26
3 0.22
4 0.25
5 0.27
6 0.31
7 0.32
8 0.31
9 0.32
10 0.3
11 0.33
12 0.36
13 0.41
14 0.47
15 0.54
16 0.6
17 0.67
18 0.71
19 0.78
20 0.81
21 0.8
22 0.8
23 0.8
24 0.78
25 0.75
26 0.67
27 0.58
28 0.49
29 0.4
30 0.3
31 0.21
32 0.15
33 0.1
34 0.09
35 0.08
36 0.06
37 0.08
38 0.09
39 0.1
40 0.1
41 0.11
42 0.13
43 0.12
44 0.13
45 0.11
46 0.16
47 0.18
48 0.2
49 0.21
50 0.2
51 0.2
52 0.24
53 0.24
54 0.25
55 0.27
56 0.29
57 0.3
58 0.33
59 0.35
60 0.33
61 0.34
62 0.29
63 0.32
64 0.31
65 0.36
66 0.38
67 0.43
68 0.51
69 0.54
70 0.55
71 0.57
72 0.61
73 0.6
74 0.63
75 0.66
76 0.68
77 0.71
78 0.77
79 0.78
80 0.79
81 0.8
82 0.81
83 0.81
84 0.78
85 0.8
86 0.8
87 0.82