Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A3G2SA79

Protein Details
Accession A0A3G2SA79    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
47-72VEKQEKPKVPKGRAKKRILFNRRFVNHydrophilic
NLS Segment(s)
PositionSequence
28-65GKVHGSLARAGKVKSQTPKVEKQEKPKVPKGRAKKRIL
Subcellular Location(s) mito 14, cyto 8, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MRVGSGGAFSTDRGKRAAVPLQPHSKMGKVHGSLARAGKVKSQTPKVEKQEKPKVPKGRAKKRILFNRRFVNAVVTPGGKRRMNPNDK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.27
4 0.33
5 0.3
6 0.34
7 0.4
8 0.47
9 0.48
10 0.48
11 0.44
12 0.4
13 0.37
14 0.34
15 0.34
16 0.27
17 0.32
18 0.32
19 0.31
20 0.31
21 0.31
22 0.31
23 0.25
24 0.24
25 0.22
26 0.23
27 0.26
28 0.28
29 0.33
30 0.36
31 0.39
32 0.47
33 0.51
34 0.58
35 0.58
36 0.62
37 0.67
38 0.68
39 0.7
40 0.71
41 0.72
42 0.71
43 0.75
44 0.76
45 0.77
46 0.8
47 0.81
48 0.8
49 0.81
50 0.84
51 0.86
52 0.83
53 0.81
54 0.8
55 0.73
56 0.67
57 0.57
58 0.53
59 0.44
60 0.38
61 0.32
62 0.25
63 0.24
64 0.28
65 0.34
66 0.3
67 0.31
68 0.38