Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1XZJ2

Protein Details
Accession K1XZJ2   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
32-54CKEAVRIRKGRRAKRPAKDHIYLBasic
NLS Segment(s)
PositionSequence
37-49RIRKGRRAKRPAK
Subcellular Location(s) mito 22, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR030664  SdhA/FrdA/AprA  
IPR027477  Succ_DH/fumarate_Rdtase_cat_sf  
KEGG mbe:MBM_03227  -  
Amino Acid Sequences MHVVTRISLERLNRRLSTSIYGASCLITEGACKEAVRIRKGRRAKRPAKDHIYLRHSHLLAEVLYERLLSIFKGASIFSGAKVRKQPILVLRTVHHNMGSIPTWHSPVAGTTKARHLATRDTSIKIIIKPQLLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.44
3 0.44
4 0.42
5 0.35
6 0.35
7 0.29
8 0.29
9 0.25
10 0.22
11 0.19
12 0.15
13 0.12
14 0.07
15 0.07
16 0.07
17 0.08
18 0.09
19 0.09
20 0.1
21 0.15
22 0.21
23 0.26
24 0.33
25 0.38
26 0.46
27 0.56
28 0.64
29 0.7
30 0.75
31 0.79
32 0.81
33 0.84
34 0.85
35 0.83
36 0.8
37 0.75
38 0.72
39 0.68
40 0.6
41 0.55
42 0.51
43 0.43
44 0.37
45 0.31
46 0.24
47 0.18
48 0.17
49 0.13
50 0.07
51 0.07
52 0.07
53 0.06
54 0.05
55 0.05
56 0.04
57 0.04
58 0.04
59 0.04
60 0.05
61 0.05
62 0.05
63 0.07
64 0.07
65 0.08
66 0.14
67 0.15
68 0.18
69 0.22
70 0.24
71 0.25
72 0.25
73 0.29
74 0.29
75 0.33
76 0.31
77 0.29
78 0.28
79 0.33
80 0.34
81 0.3
82 0.23
83 0.2
84 0.18
85 0.19
86 0.2
87 0.14
88 0.15
89 0.16
90 0.18
91 0.17
92 0.17
93 0.14
94 0.15
95 0.19
96 0.2
97 0.21
98 0.22
99 0.28
100 0.34
101 0.34
102 0.34
103 0.33
104 0.37
105 0.4
106 0.47
107 0.44
108 0.41
109 0.41
110 0.43
111 0.43
112 0.36
113 0.37
114 0.34