Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9ZFQ2

Protein Details
Accession A0A4P9ZFQ2   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
10-35CDVVSTEKKKSNRKKKDPDAPKRSLSHydrophilic
NLS Segment(s)
PositionSequence
17-31KKKSNRKKKDPDAPK
Subcellular Location(s) nucl 15.5, cyto_nucl 11.5, cyto 6.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01390  HMG-box_NHP6-like  
Amino Acid Sequences MSRQFLDPGCDVVSTEKKKSNRKKKDPDAPKRSLSAYMFFANENRDIVRAENPGIAFGQVGKVLGEKWKLLGADDKAPYEAKAAADKKRYEKEKAEYVKRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.33
3 0.38
4 0.44
5 0.55
6 0.66
7 0.71
8 0.73
9 0.8
10 0.86
11 0.9
12 0.93
13 0.94
14 0.94
15 0.92
16 0.87
17 0.79
18 0.7
19 0.61
20 0.55
21 0.45
22 0.37
23 0.3
24 0.26
25 0.23
26 0.21
27 0.2
28 0.17
29 0.16
30 0.14
31 0.11
32 0.1
33 0.1
34 0.11
35 0.12
36 0.11
37 0.11
38 0.12
39 0.12
40 0.12
41 0.11
42 0.1
43 0.07
44 0.06
45 0.06
46 0.05
47 0.05
48 0.05
49 0.05
50 0.06
51 0.09
52 0.1
53 0.09
54 0.1
55 0.12
56 0.12
57 0.13
58 0.18
59 0.18
60 0.23
61 0.24
62 0.24
63 0.23
64 0.24
65 0.23
66 0.2
67 0.19
68 0.14
69 0.21
70 0.25
71 0.3
72 0.37
73 0.41
74 0.48
75 0.55
76 0.59
77 0.58
78 0.62
79 0.63
80 0.66
81 0.71