Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1XJ15

Protein Details
Accession K1XJ15   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
206-225SSVIETRKTKKERNPPTADLHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 18, mito 8
Family & Domain DBs
KEGG mbe:MBM_09345  -  
Amino Acid Sequences MAPLQLFPSFIYLLTLLTTPLLARNSHRPPNTCPTITKFTTPTSCPPTTPSVCPQPDCILVSPITVPCGCPTTIPTSAVHCAAAPMPSFHVEREKDPVGFDAATTGTYTYSDCDSDTATATGFVQDNHGDGGAGVLDGRVRHICGARLRLARKESILDIKPDGAYEYRFEKQILFLNSQDLIGILRVAWPLGLTKSTHPPPPPVSSSVIETRKTKKERNPPTADLLLLPQFDPPRAYPLETNQFQLGSAPRKGVLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.09
4 0.09
5 0.09
6 0.07
7 0.11
8 0.13
9 0.13
10 0.17
11 0.27
12 0.35
13 0.43
14 0.49
15 0.49
16 0.54
17 0.62
18 0.66
19 0.59
20 0.55
21 0.54
22 0.56
23 0.54
24 0.51
25 0.44
26 0.42
27 0.44
28 0.43
29 0.43
30 0.43
31 0.43
32 0.39
33 0.4
34 0.43
35 0.41
36 0.42
37 0.41
38 0.43
39 0.45
40 0.45
41 0.45
42 0.4
43 0.39
44 0.37
45 0.33
46 0.25
47 0.22
48 0.22
49 0.2
50 0.16
51 0.16
52 0.13
53 0.12
54 0.11
55 0.13
56 0.13
57 0.12
58 0.14
59 0.18
60 0.2
61 0.21
62 0.2
63 0.21
64 0.23
65 0.23
66 0.21
67 0.14
68 0.13
69 0.12
70 0.13
71 0.1
72 0.09
73 0.09
74 0.12
75 0.12
76 0.12
77 0.19
78 0.18
79 0.19
80 0.25
81 0.25
82 0.23
83 0.23
84 0.23
85 0.18
86 0.17
87 0.15
88 0.1
89 0.09
90 0.08
91 0.08
92 0.07
93 0.05
94 0.06
95 0.06
96 0.06
97 0.07
98 0.07
99 0.07
100 0.07
101 0.08
102 0.08
103 0.09
104 0.08
105 0.07
106 0.07
107 0.06
108 0.07
109 0.07
110 0.06
111 0.07
112 0.07
113 0.07
114 0.07
115 0.07
116 0.05
117 0.05
118 0.05
119 0.03
120 0.03
121 0.03
122 0.02
123 0.03
124 0.03
125 0.05
126 0.05
127 0.05
128 0.07
129 0.08
130 0.12
131 0.15
132 0.19
133 0.24
134 0.29
135 0.31
136 0.34
137 0.35
138 0.33
139 0.31
140 0.29
141 0.25
142 0.26
143 0.26
144 0.23
145 0.22
146 0.22
147 0.2
148 0.19
149 0.18
150 0.12
151 0.11
152 0.11
153 0.15
154 0.15
155 0.16
156 0.16
157 0.15
158 0.17
159 0.22
160 0.23
161 0.22
162 0.21
163 0.22
164 0.22
165 0.21
166 0.19
167 0.13
168 0.1
169 0.07
170 0.07
171 0.04
172 0.05
173 0.06
174 0.06
175 0.05
176 0.05
177 0.06
178 0.07
179 0.09
180 0.09
181 0.13
182 0.21
183 0.24
184 0.3
185 0.3
186 0.35
187 0.38
188 0.43
189 0.44
190 0.39
191 0.4
192 0.36
193 0.38
194 0.41
195 0.41
196 0.38
197 0.39
198 0.43
199 0.48
200 0.54
201 0.58
202 0.59
203 0.66
204 0.73
205 0.79
206 0.81
207 0.75
208 0.76
209 0.69
210 0.6
211 0.5
212 0.43
213 0.35
214 0.27
215 0.23
216 0.2
217 0.19
218 0.2
219 0.22
220 0.19
221 0.22
222 0.24
223 0.27
224 0.26
225 0.33
226 0.42
227 0.41
228 0.43
229 0.38
230 0.36
231 0.33
232 0.33
233 0.32
234 0.28
235 0.28
236 0.27