Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9ZJY7

Protein Details
Accession A0A4P9ZJY7    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
72-92QDIMRWRKKQLNKANALKIKAHydrophilic
NLS Segment(s)
PositionSequence
99-99K
Subcellular Location(s) mito 24, nucl 1, cyto 1, extr 1, cyto_nucl 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MLRFLRLLLARPFSSAIVRANRAPSSCPAGTVLNLKVRKNGDEPVALENSEYPDWLWTILDKEANDELLKSQDIMRWRKKQLNKANALKIKANNFLSKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.24
3 0.24
4 0.25
5 0.27
6 0.28
7 0.31
8 0.32
9 0.31
10 0.31
11 0.28
12 0.3
13 0.27
14 0.26
15 0.23
16 0.22
17 0.22
18 0.23
19 0.23
20 0.24
21 0.27
22 0.26
23 0.29
24 0.29
25 0.31
26 0.29
27 0.29
28 0.24
29 0.23
30 0.24
31 0.22
32 0.21
33 0.19
34 0.16
35 0.14
36 0.13
37 0.11
38 0.1
39 0.07
40 0.07
41 0.07
42 0.07
43 0.07
44 0.05
45 0.07
46 0.08
47 0.1
48 0.09
49 0.12
50 0.12
51 0.13
52 0.13
53 0.11
54 0.11
55 0.11
56 0.11
57 0.09
58 0.1
59 0.12
60 0.19
61 0.27
62 0.36
63 0.42
64 0.48
65 0.56
66 0.63
67 0.71
68 0.75
69 0.77
70 0.78
71 0.79
72 0.83
73 0.8
74 0.76
75 0.72
76 0.67
77 0.62
78 0.6
79 0.55
80 0.54