Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9ZDX9

Protein Details
Accession A0A4P9ZDX9   
Localization Confidence Low
Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
87-109MEQRNRTKGRRGPGNFQKRNNDYHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR034101  Lsm4  
IPR027141  LSm4/Sm_D1/D3  
IPR010920  LSM_dom_sf  
IPR047575  Sm  
IPR001163  Sm_dom_euk/arc  
Gene Ontology GO:0120114  C:Sm-like protein family complex  
GO:0005681  C:spliceosomal complex  
GO:0003723  F:RNA binding  
GO:0000398  P:mRNA splicing, via spliceosome  
GO:0000956  P:nuclear-transcribed mRNA catabolic process  
Pfam View protein in Pfam  
PF01423  LSM  
PROSITE View protein in PROSITE  
PS52002  SM  
CDD cd01723  LSm4  
Amino Acid Sequences QLPLYMLTSIKKQKILVELKNGETIFGKLNNCDSWMNLTLSDAIYNFNNGEKFNKLEEIYVRGNHIKFLRLPDTVMEQAKEQNMLNMEQRNRTKGRRGPGNFQKRNNDYGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.51
3 0.49
4 0.51
5 0.51
6 0.5
7 0.54
8 0.49
9 0.4
10 0.33
11 0.28
12 0.21
13 0.21
14 0.2
15 0.16
16 0.19
17 0.18
18 0.2
19 0.19
20 0.17
21 0.18
22 0.19
23 0.19
24 0.16
25 0.16
26 0.14
27 0.14
28 0.14
29 0.09
30 0.08
31 0.07
32 0.08
33 0.08
34 0.08
35 0.09
36 0.09
37 0.11
38 0.11
39 0.13
40 0.13
41 0.15
42 0.14
43 0.14
44 0.14
45 0.17
46 0.17
47 0.16
48 0.18
49 0.19
50 0.18
51 0.2
52 0.2
53 0.18
54 0.17
55 0.22
56 0.23
57 0.2
58 0.21
59 0.19
60 0.23
61 0.24
62 0.24
63 0.19
64 0.17
65 0.19
66 0.19
67 0.2
68 0.15
69 0.15
70 0.15
71 0.16
72 0.2
73 0.24
74 0.26
75 0.32
76 0.35
77 0.39
78 0.43
79 0.46
80 0.51
81 0.51
82 0.58
83 0.61
84 0.64
85 0.68
86 0.74
87 0.8
88 0.79
89 0.81
90 0.82
91 0.75