Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V1J2V9

Protein Details
Accession A0A4V1J2V9   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
98-131LDSVLRKRRLKMKKHKLRKRRKRQRSLKIRLGKIBasic
NLS Segment(s)
PositionSequence
103-131RKRRLKMKKHKLRKRRKRQRSLKIRLGKI
Subcellular Location(s) mito 21, nucl 5.5, cyto_nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013177  COX24_C  
Pfam View protein in Pfam  
PF08213  COX24_C  
Amino Acid Sequences MLRIGLARCPGLGAWFLSAILRPRGVTPPLLSCTLLAIQRLAEIQPHPTQTSQVLRMLQPLARIPQPSIFFPQIGHVQQSPISPEASESKEADNTVHLDSVLRKRRLKMKKHKLRKRRKRQRSLKIRLGKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.11
4 0.11
5 0.13
6 0.15
7 0.15
8 0.15
9 0.15
10 0.17
11 0.21
12 0.22
13 0.23
14 0.22
15 0.25
16 0.26
17 0.28
18 0.25
19 0.21
20 0.21
21 0.21
22 0.19
23 0.15
24 0.12
25 0.11
26 0.11
27 0.11
28 0.09
29 0.09
30 0.09
31 0.12
32 0.14
33 0.16
34 0.17
35 0.17
36 0.18
37 0.19
38 0.22
39 0.21
40 0.21
41 0.2
42 0.19
43 0.21
44 0.21
45 0.18
46 0.16
47 0.15
48 0.14
49 0.14
50 0.15
51 0.13
52 0.17
53 0.17
54 0.17
55 0.2
56 0.19
57 0.17
58 0.17
59 0.19
60 0.18
61 0.17
62 0.18
63 0.14
64 0.14
65 0.15
66 0.15
67 0.15
68 0.12
69 0.12
70 0.1
71 0.11
72 0.14
73 0.15
74 0.17
75 0.16
76 0.17
77 0.18
78 0.18
79 0.17
80 0.15
81 0.15
82 0.13
83 0.13
84 0.11
85 0.11
86 0.16
87 0.25
88 0.33
89 0.37
90 0.39
91 0.45
92 0.55
93 0.63
94 0.7
95 0.72
96 0.74
97 0.79
98 0.87
99 0.92
100 0.93
101 0.95
102 0.96
103 0.96
104 0.96
105 0.96
106 0.96
107 0.96
108 0.97
109 0.96
110 0.96
111 0.95