Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9ZFL7

Protein Details
Accession A0A4P9ZFL7   
Localization Confidence Low
Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
15-43YLWKKAPRLSPPQKYRLRKRMRLVDHNIEHydrophilic
93-113RSVHLEPKWTKRSFRKNPEYFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18.5, mito_nucl 13.5, nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFRATLTAYGGYLWKKAPRLSPPQKYRLRKRMRLVDHNIEVLYQSLKKPGEELTGYRNIDALKFDFPKESEMLPRDKYTTFNRKAKDYRRSVHLEPKWTKRSFRKNPEYF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.19
4 0.2
5 0.22
6 0.26
7 0.32
8 0.37
9 0.47
10 0.55
11 0.63
12 0.67
13 0.73
14 0.79
15 0.82
16 0.85
17 0.85
18 0.85
19 0.83
20 0.84
21 0.84
22 0.83
23 0.83
24 0.8
25 0.78
26 0.69
27 0.62
28 0.52
29 0.42
30 0.33
31 0.24
32 0.18
33 0.1
34 0.09
35 0.12
36 0.12
37 0.12
38 0.13
39 0.13
40 0.15
41 0.15
42 0.16
43 0.16
44 0.22
45 0.22
46 0.21
47 0.21
48 0.18
49 0.17
50 0.18
51 0.14
52 0.12
53 0.14
54 0.14
55 0.15
56 0.15
57 0.17
58 0.17
59 0.17
60 0.18
61 0.2
62 0.23
63 0.24
64 0.25
65 0.25
66 0.24
67 0.28
68 0.32
69 0.39
70 0.44
71 0.48
72 0.5
73 0.55
74 0.64
75 0.69
76 0.7
77 0.68
78 0.65
79 0.66
80 0.71
81 0.68
82 0.69
83 0.66
84 0.66
85 0.65
86 0.69
87 0.71
88 0.67
89 0.71
90 0.71
91 0.77
92 0.78
93 0.81