Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9ZDP4

Protein Details
Accession A0A4P9ZDP4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
15-40AALAGGKKGKKKWNKGKVKDKAQHVVHydrophilic
NLS Segment(s)
PositionSequence
12-35KAAAALAGGKKGKKKWNKGKVKDK
Subcellular Location(s) cyto 21.5, cyto_nucl 12, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPKIQQTKAAKAAAALAGGKKGKKKWNKGKVKDKAQHVVILDQEKHDRIMKEVPGFKYVSVSVLVDRLKIGGSMARVALKQLESEGVIKPIVKHSKQAIYTRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.26
3 0.2
4 0.13
5 0.16
6 0.19
7 0.21
8 0.23
9 0.29
10 0.37
11 0.46
12 0.56
13 0.63
14 0.71
15 0.8
16 0.85
17 0.9
18 0.9
19 0.91
20 0.87
21 0.83
22 0.79
23 0.69
24 0.62
25 0.52
26 0.44
27 0.35
28 0.32
29 0.26
30 0.2
31 0.2
32 0.17
33 0.18
34 0.19
35 0.17
36 0.15
37 0.19
38 0.2
39 0.23
40 0.27
41 0.27
42 0.26
43 0.26
44 0.24
45 0.22
46 0.19
47 0.15
48 0.11
49 0.1
50 0.08
51 0.11
52 0.12
53 0.1
54 0.1
55 0.09
56 0.09
57 0.08
58 0.08
59 0.07
60 0.08
61 0.09
62 0.1
63 0.11
64 0.11
65 0.11
66 0.13
67 0.12
68 0.11
69 0.11
70 0.11
71 0.11
72 0.13
73 0.13
74 0.13
75 0.13
76 0.14
77 0.14
78 0.22
79 0.3
80 0.3
81 0.34
82 0.39
83 0.47
84 0.52