Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9Z7S1

Protein Details
Accession A0A4P9Z7S1    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-20KLNKNKKLIKKLAKKYNAFIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR023674  Ribosomal_L1-like  
IPR016095  Ribosomal_L1_3-a/b-sand  
Amino Acid Sequences KLNKNKKLIKKLAKKYNAFIASEVLIKQVPRLLAGTYAIQGNIFSQNTHSNILDILKKRMYILANAQKNFAETPLTAAPNIEDDISRLVQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.76
3 0.76
4 0.68
5 0.59
6 0.49
7 0.4
8 0.32
9 0.29
10 0.25
11 0.16
12 0.13
13 0.12
14 0.11
15 0.12
16 0.1
17 0.1
18 0.11
19 0.1
20 0.1
21 0.11
22 0.11
23 0.09
24 0.1
25 0.09
26 0.08
27 0.07
28 0.07
29 0.08
30 0.08
31 0.07
32 0.09
33 0.11
34 0.13
35 0.15
36 0.14
37 0.11
38 0.12
39 0.14
40 0.17
41 0.16
42 0.18
43 0.17
44 0.18
45 0.18
46 0.21
47 0.2
48 0.18
49 0.26
50 0.32
51 0.38
52 0.38
53 0.39
54 0.36
55 0.36
56 0.33
57 0.25
58 0.18
59 0.11
60 0.16
61 0.19
62 0.2
63 0.18
64 0.18
65 0.18
66 0.18
67 0.18
68 0.14
69 0.1
70 0.1
71 0.14