Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9ZFR4

Protein Details
Accession A0A4P9ZFR4    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MVALPSTKKKHSEKHKQIFRQLLKEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, mito_nucl 11.833, mito 9, cyto_nucl 8.666, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR037278  ARFGAP/RecO  
IPR001164  ArfGAP_dom  
IPR038508  ArfGAP_dom_sf  
IPR000679  Znf_GATA  
Gene Ontology GO:0005096  F:GTPase activator activity  
GO:0043565  F:sequence-specific DNA binding  
GO:0006355  P:regulation of DNA-templated transcription  
Pfam View protein in Pfam  
PF01412  ArfGap  
PROSITE View protein in PROSITE  
PS50115  ARFGAP  
PS50114  GATA_ZN_FINGER_2  
Amino Acid Sequences MVALPSTKKKHSEKHKQIFRQLLKEPANKVCVDCKTSTLPRWASWNLGCFFCIRCSGIHRSMGTHISRVKSVDLDAWTDEQVDSMVKWGNEKCNLYWEAKLPQGYVPDSSKIENFIRTKYDMKKWA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.86
3 0.86
4 0.87
5 0.88
6 0.84
7 0.8
8 0.72
9 0.71
10 0.68
11 0.64
12 0.6
13 0.54
14 0.51
15 0.44
16 0.41
17 0.38
18 0.34
19 0.34
20 0.3
21 0.28
22 0.31
23 0.35
24 0.37
25 0.38
26 0.36
27 0.33
28 0.38
29 0.36
30 0.33
31 0.3
32 0.33
33 0.27
34 0.25
35 0.24
36 0.2
37 0.2
38 0.17
39 0.16
40 0.12
41 0.11
42 0.15
43 0.2
44 0.22
45 0.25
46 0.24
47 0.23
48 0.25
49 0.28
50 0.24
51 0.22
52 0.21
53 0.19
54 0.19
55 0.19
56 0.17
57 0.13
58 0.14
59 0.14
60 0.12
61 0.12
62 0.12
63 0.12
64 0.12
65 0.12
66 0.11
67 0.08
68 0.08
69 0.07
70 0.06
71 0.06
72 0.08
73 0.08
74 0.11
75 0.13
76 0.18
77 0.23
78 0.26
79 0.25
80 0.29
81 0.31
82 0.31
83 0.31
84 0.29
85 0.28
86 0.3
87 0.3
88 0.25
89 0.25
90 0.26
91 0.25
92 0.25
93 0.24
94 0.24
95 0.25
96 0.26
97 0.24
98 0.26
99 0.26
100 0.3
101 0.3
102 0.29
103 0.32
104 0.34
105 0.4
106 0.43