Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9ZEC1

Protein Details
Accession A0A4P9ZEC1    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
18-44LAMFENARRPRKKKGLSKPYVFKKKPLHydrophilic
NLS Segment(s)
PositionSequence
25-44RRPRKKKGLSKPYVFKKKPL
Subcellular Location(s) nucl 18.5, mito_nucl 12, mito 4.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR039024  RTC4  
IPR028094  RTC4_C  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF14474  RTC4  
Amino Acid Sequences MSNHTPDRISSKRRCSTLAMFENARRPRKKKGLSKPYVFKKKPLEKLIAIKPAEDANTPKTNFEELDELLKPRDFTNMLENAPVSLLPLLILQGDINSANAAPVRAKYASKTFPLPKSKQRLKLRVSALLPVVKRLLEGAEELSYHYTRASAQRKLLKNATMSSSEHWDVRWDEYVGGFYGFRRQAFISELIQAEYADLLPKIRNKTISYWSPDMFCMYVLANEIILRLIMEDMQLLKQETETVMKETADYGCHIADEQEFTDDLNLAEFQVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.65
3 0.64
4 0.65
5 0.62
6 0.57
7 0.53
8 0.54
9 0.6
10 0.61
11 0.63
12 0.61
13 0.58
14 0.64
15 0.7
16 0.77
17 0.78
18 0.82
19 0.84
20 0.85
21 0.9
22 0.9
23 0.9
24 0.91
25 0.82
26 0.79
27 0.78
28 0.78
29 0.78
30 0.75
31 0.71
32 0.65
33 0.72
34 0.71
35 0.69
36 0.59
37 0.5
38 0.44
39 0.39
40 0.35
41 0.28
42 0.23
43 0.21
44 0.28
45 0.28
46 0.28
47 0.28
48 0.28
49 0.26
50 0.25
51 0.22
52 0.16
53 0.2
54 0.21
55 0.2
56 0.2
57 0.2
58 0.19
59 0.16
60 0.19
61 0.15
62 0.16
63 0.22
64 0.24
65 0.23
66 0.23
67 0.23
68 0.19
69 0.18
70 0.16
71 0.1
72 0.06
73 0.05
74 0.05
75 0.05
76 0.05
77 0.04
78 0.05
79 0.04
80 0.04
81 0.05
82 0.04
83 0.04
84 0.04
85 0.04
86 0.05
87 0.05
88 0.05
89 0.05
90 0.06
91 0.09
92 0.1
93 0.11
94 0.13
95 0.18
96 0.21
97 0.22
98 0.28
99 0.31
100 0.37
101 0.45
102 0.48
103 0.5
104 0.57
105 0.63
106 0.67
107 0.71
108 0.72
109 0.67
110 0.7
111 0.65
112 0.61
113 0.54
114 0.46
115 0.39
116 0.34
117 0.3
118 0.23
119 0.2
120 0.14
121 0.13
122 0.11
123 0.09
124 0.06
125 0.06
126 0.06
127 0.06
128 0.06
129 0.07
130 0.08
131 0.08
132 0.08
133 0.07
134 0.06
135 0.07
136 0.16
137 0.21
138 0.22
139 0.28
140 0.36
141 0.39
142 0.44
143 0.46
144 0.41
145 0.38
146 0.36
147 0.33
148 0.28
149 0.26
150 0.22
151 0.23
152 0.21
153 0.19
154 0.17
155 0.18
156 0.16
157 0.17
158 0.18
159 0.14
160 0.14
161 0.14
162 0.15
163 0.12
164 0.11
165 0.09
166 0.07
167 0.13
168 0.15
169 0.14
170 0.16
171 0.15
172 0.16
173 0.19
174 0.22
175 0.17
176 0.18
177 0.18
178 0.17
179 0.17
180 0.15
181 0.12
182 0.09
183 0.08
184 0.06
185 0.06
186 0.07
187 0.09
188 0.14
189 0.18
190 0.21
191 0.25
192 0.27
193 0.32
194 0.39
195 0.43
196 0.46
197 0.46
198 0.44
199 0.41
200 0.39
201 0.36
202 0.28
203 0.21
204 0.15
205 0.11
206 0.11
207 0.11
208 0.11
209 0.09
210 0.09
211 0.09
212 0.08
213 0.07
214 0.06
215 0.05
216 0.05
217 0.05
218 0.05
219 0.06
220 0.07
221 0.08
222 0.1
223 0.11
224 0.11
225 0.11
226 0.12
227 0.12
228 0.15
229 0.16
230 0.17
231 0.18
232 0.18
233 0.18
234 0.18
235 0.18
236 0.16
237 0.16
238 0.14
239 0.13
240 0.13
241 0.13
242 0.13
243 0.13
244 0.14
245 0.14
246 0.14
247 0.14
248 0.14
249 0.15
250 0.14
251 0.12
252 0.11
253 0.1