Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9ZCL4

Protein Details
Accession A0A4P9ZCL4    Localization Confidence Low Confidence Score 5.5
NoLS Segment(s)
PositionSequenceProtein Nature
105-124SPENQFKRLQRQLRPSPRLLHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 9, mito 7, cyto 5.5, cyto_nucl 4, plas 2, nucl 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR005164  Allantoicase  
IPR015908  Allantoicase_dom  
IPR008979  Galactose-bd-like_sf  
Gene Ontology GO:0004037  F:allantoicase activity  
GO:0000256  P:allantoin catabolic process  
Pfam View protein in Pfam  
PF03561  Allantoicase  
Amino Acid Sequences MHPGDGIARFRLYGVVVSVLPKDISAVLDMASVKNDGVAIRVSDQHFGSADNLLLPGRGHDMSDGWETKRSRTPGHVDWVVIMLGAATSIQRIVVDTAHFRGNFSPENQFKRLQRQLRPSPRLLSAGRVGRRQQDWSG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.12
4 0.13
5 0.13
6 0.13
7 0.12
8 0.11
9 0.1
10 0.09
11 0.09
12 0.09
13 0.08
14 0.07
15 0.09
16 0.1
17 0.09
18 0.09
19 0.09
20 0.08
21 0.08
22 0.08
23 0.06
24 0.07
25 0.08
26 0.08
27 0.09
28 0.13
29 0.14
30 0.15
31 0.16
32 0.15
33 0.14
34 0.14
35 0.14
36 0.11
37 0.1
38 0.07
39 0.08
40 0.07
41 0.07
42 0.06
43 0.05
44 0.07
45 0.07
46 0.07
47 0.07
48 0.08
49 0.1
50 0.13
51 0.13
52 0.11
53 0.17
54 0.18
55 0.2
56 0.25
57 0.24
58 0.23
59 0.26
60 0.32
61 0.29
62 0.35
63 0.34
64 0.28
65 0.27
66 0.26
67 0.21
68 0.15
69 0.11
70 0.05
71 0.03
72 0.03
73 0.03
74 0.02
75 0.02
76 0.02
77 0.03
78 0.03
79 0.04
80 0.05
81 0.06
82 0.08
83 0.09
84 0.11
85 0.15
86 0.15
87 0.16
88 0.16
89 0.19
90 0.2
91 0.21
92 0.28
93 0.31
94 0.37
95 0.39
96 0.44
97 0.44
98 0.51
99 0.58
100 0.58
101 0.6
102 0.64
103 0.72
104 0.78
105 0.81
106 0.75
107 0.7
108 0.65
109 0.62
110 0.53
111 0.48
112 0.44
113 0.46
114 0.46
115 0.48
116 0.48
117 0.5
118 0.53