Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9ZHL4

Protein Details
Accession A0A4P9ZHL4    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
5-25AKKYPLWKRVLHKFQARREIPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 6.5, cyto_mito 6.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007763  NDUFA12  
Gene Ontology GO:0016020  C:membrane  
GO:0032981  P:mitochondrial respiratory chain complex I assembly  
Pfam View protein in Pfam  
PF05071  NDUFA12  
Amino Acid Sequences MDQIAKKYPLWKRVLHKFQARREIPFRRRFFVGYDLHGNTYWEFTPDGNMRRLRRKLEPWRETLFKVDHFSTVPPKWLQWLRRTREMPPTLQELIDDKIRQQRIKLLAQQADQKWLMKKARLEQEQQLKFQAELGRVETEKAELERQNAQNMAQYEEAATGAEDPYAAAAESAGKDPIVSANIKPRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.73
3 0.76
4 0.76
5 0.8
6 0.83
7 0.77
8 0.73
9 0.73
10 0.75
11 0.75
12 0.76
13 0.71
14 0.65
15 0.65
16 0.59
17 0.53
18 0.5
19 0.44
20 0.39
21 0.4
22 0.37
23 0.36
24 0.35
25 0.32
26 0.24
27 0.23
28 0.18
29 0.13
30 0.12
31 0.11
32 0.16
33 0.2
34 0.23
35 0.27
36 0.33
37 0.36
38 0.45
39 0.5
40 0.5
41 0.52
42 0.59
43 0.64
44 0.7
45 0.71
46 0.67
47 0.68
48 0.66
49 0.59
50 0.53
51 0.45
52 0.36
53 0.34
54 0.28
55 0.23
56 0.21
57 0.22
58 0.23
59 0.22
60 0.23
61 0.2
62 0.19
63 0.23
64 0.28
65 0.31
66 0.34
67 0.42
68 0.44
69 0.52
70 0.54
71 0.52
72 0.56
73 0.54
74 0.47
75 0.4
76 0.4
77 0.32
78 0.29
79 0.27
80 0.18
81 0.17
82 0.17
83 0.15
84 0.12
85 0.17
86 0.21
87 0.21
88 0.2
89 0.24
90 0.27
91 0.32
92 0.35
93 0.35
94 0.35
95 0.37
96 0.43
97 0.37
98 0.36
99 0.32
100 0.3
101 0.26
102 0.29
103 0.3
104 0.27
105 0.31
106 0.34
107 0.43
108 0.45
109 0.46
110 0.47
111 0.55
112 0.54
113 0.52
114 0.47
115 0.38
116 0.34
117 0.34
118 0.29
119 0.21
120 0.19
121 0.2
122 0.2
123 0.2
124 0.2
125 0.17
126 0.15
127 0.14
128 0.15
129 0.17
130 0.16
131 0.19
132 0.26
133 0.28
134 0.3
135 0.29
136 0.28
137 0.28
138 0.28
139 0.28
140 0.21
141 0.19
142 0.16
143 0.16
144 0.15
145 0.1
146 0.09
147 0.07
148 0.06
149 0.06
150 0.05
151 0.05
152 0.05
153 0.05
154 0.05
155 0.04
156 0.04
157 0.07
158 0.08
159 0.1
160 0.1
161 0.09
162 0.09
163 0.1
164 0.12
165 0.13
166 0.14
167 0.16