Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

K1WHK2

Protein Details
Accession K1WHK2    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
169-197AEEKPKPVKERLWKRIRHKVKRVLGDEDEBasic
NLS Segment(s)
PositionSequence
171-191EKPKPVKERLWKRIRHKVKRV
Subcellular Location(s) cyto_nucl 13.333, nucl 12.5, cyto 12, mito_nucl 7.166
Family & Domain DBs
KEGG mbe:MBM_09506  -  
Amino Acid Sequences MAEPCAAYGGELELSDLVRQGMEYHHGYCNKIKEIEAVGDVVAKKEMLDSVTNNLLENLTNQDMALSPFLCGITELLIGQIGDAKDHSTLEHVEAALENFNQAIAASTLSGDIQVIGFLQTQAGNEILRLQHQAKQRKQRVLSSVGSASGVRSTLEKTPNTGQPKDSHAEEKPKPVKERLWKRIRHKVKRVLGDEDEKKSAARQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.09
3 0.09
4 0.08
5 0.07
6 0.07
7 0.07
8 0.08
9 0.13
10 0.15
11 0.17
12 0.23
13 0.26
14 0.28
15 0.32
16 0.36
17 0.36
18 0.35
19 0.33
20 0.3
21 0.31
22 0.3
23 0.26
24 0.21
25 0.16
26 0.18
27 0.17
28 0.14
29 0.12
30 0.1
31 0.09
32 0.09
33 0.1
34 0.09
35 0.1
36 0.11
37 0.14
38 0.18
39 0.18
40 0.18
41 0.17
42 0.15
43 0.13
44 0.13
45 0.14
46 0.11
47 0.11
48 0.1
49 0.1
50 0.1
51 0.11
52 0.12
53 0.08
54 0.07
55 0.07
56 0.08
57 0.07
58 0.07
59 0.06
60 0.06
61 0.06
62 0.05
63 0.05
64 0.05
65 0.05
66 0.05
67 0.07
68 0.06
69 0.06
70 0.06
71 0.07
72 0.07
73 0.07
74 0.07
75 0.06
76 0.07
77 0.08
78 0.09
79 0.08
80 0.08
81 0.08
82 0.08
83 0.07
84 0.06
85 0.05
86 0.04
87 0.04
88 0.04
89 0.03
90 0.04
91 0.03
92 0.04
93 0.04
94 0.04
95 0.04
96 0.04
97 0.04
98 0.03
99 0.03
100 0.03
101 0.03
102 0.03
103 0.04
104 0.04
105 0.04
106 0.04
107 0.05
108 0.05
109 0.06
110 0.06
111 0.06
112 0.05
113 0.07
114 0.07
115 0.08
116 0.11
117 0.12
118 0.16
119 0.24
120 0.34
121 0.4
122 0.51
123 0.57
124 0.63
125 0.65
126 0.66
127 0.64
128 0.61
129 0.55
130 0.48
131 0.41
132 0.33
133 0.3
134 0.23
135 0.18
136 0.13
137 0.11
138 0.08
139 0.08
140 0.1
141 0.14
142 0.2
143 0.2
144 0.24
145 0.29
146 0.36
147 0.41
148 0.41
149 0.39
150 0.37
151 0.41
152 0.41
153 0.39
154 0.37
155 0.36
156 0.43
157 0.43
158 0.51
159 0.53
160 0.57
161 0.59
162 0.59
163 0.63
164 0.64
165 0.72
166 0.73
167 0.75
168 0.77
169 0.82
170 0.87
171 0.89
172 0.89
173 0.89
174 0.88
175 0.88
176 0.88
177 0.84
178 0.81
179 0.76
180 0.75
181 0.71
182 0.66
183 0.59
184 0.5