Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9ZCW0

Protein Details
Accession A0A4P9ZCW0    Localization Confidence Medium Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
7-34NSPAPLTPANKREKRRHHVATKLSKLEMHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR013907  Sds3  
Gene Ontology GO:0005654  C:nucleoplasm  
Pfam View protein in Pfam  
PF08598  Sds3  
Amino Acid Sequences MSSRYANSPAPLTPANKREKRRHHVATKLSKLEMSFAEERNNFYRAMLVHLQSTLASIQLGVNEEYQARRAKQEEIRDYELTRLRLWEEYQVKRVEDEYKEDMAVTKENYDMLIRILKEKFYDKLQRQVKQLKEDKLLLNLVNASLWTPNGTQMSTASALAAAAPSFSMNDRRSLRKRELHARLLPGEADDLSDTNSNSGAGRNSAAGYISASGKRRRHYATRYLSNDELSSGMTSTSNNQHNGERLQYLAGGGNESNLSDKDYDTLNSLIANKEDGGVSEIFVKRRAGARPNTRQKQFVGVQGLKVEELNDDLTVLRNAVKQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.5
3 0.56
4 0.64
5 0.7
6 0.76
7 0.81
8 0.84
9 0.85
10 0.84
11 0.86
12 0.87
13 0.87
14 0.85
15 0.81
16 0.72
17 0.63
18 0.53
19 0.47
20 0.38
21 0.34
22 0.29
23 0.26
24 0.33
25 0.32
26 0.36
27 0.36
28 0.36
29 0.29
30 0.24
31 0.26
32 0.19
33 0.24
34 0.25
35 0.23
36 0.22
37 0.22
38 0.23
39 0.19
40 0.19
41 0.13
42 0.09
43 0.07
44 0.06
45 0.07
46 0.08
47 0.1
48 0.1
49 0.1
50 0.11
51 0.12
52 0.13
53 0.16
54 0.2
55 0.19
56 0.22
57 0.23
58 0.3
59 0.35
60 0.44
61 0.48
62 0.5
63 0.55
64 0.52
65 0.51
66 0.5
67 0.49
68 0.41
69 0.33
70 0.28
71 0.24
72 0.24
73 0.24
74 0.27
75 0.3
76 0.32
77 0.37
78 0.38
79 0.37
80 0.35
81 0.36
82 0.33
83 0.27
84 0.29
85 0.28
86 0.26
87 0.26
88 0.25
89 0.24
90 0.2
91 0.2
92 0.15
93 0.12
94 0.11
95 0.11
96 0.11
97 0.1
98 0.09
99 0.09
100 0.12
101 0.11
102 0.15
103 0.16
104 0.16
105 0.17
106 0.19
107 0.2
108 0.23
109 0.32
110 0.31
111 0.4
112 0.46
113 0.49
114 0.54
115 0.6
116 0.57
117 0.58
118 0.62
119 0.58
120 0.54
121 0.53
122 0.47
123 0.42
124 0.39
125 0.3
126 0.23
127 0.18
128 0.14
129 0.1
130 0.09
131 0.07
132 0.05
133 0.05
134 0.06
135 0.06
136 0.08
137 0.09
138 0.09
139 0.08
140 0.08
141 0.1
142 0.1
143 0.09
144 0.07
145 0.06
146 0.06
147 0.06
148 0.06
149 0.03
150 0.02
151 0.02
152 0.03
153 0.03
154 0.04
155 0.1
156 0.1
157 0.17
158 0.2
159 0.27
160 0.33
161 0.39
162 0.46
163 0.47
164 0.52
165 0.56
166 0.61
167 0.61
168 0.59
169 0.56
170 0.5
171 0.44
172 0.38
173 0.28
174 0.21
175 0.13
176 0.1
177 0.07
178 0.06
179 0.07
180 0.08
181 0.07
182 0.07
183 0.07
184 0.07
185 0.07
186 0.08
187 0.07
188 0.07
189 0.08
190 0.08
191 0.08
192 0.08
193 0.08
194 0.07
195 0.07
196 0.07
197 0.09
198 0.11
199 0.15
200 0.22
201 0.26
202 0.29
203 0.34
204 0.38
205 0.45
206 0.49
207 0.56
208 0.58
209 0.64
210 0.66
211 0.65
212 0.61
213 0.53
214 0.46
215 0.36
216 0.27
217 0.18
218 0.14
219 0.09
220 0.08
221 0.07
222 0.07
223 0.1
224 0.17
225 0.2
226 0.22
227 0.24
228 0.25
229 0.29
230 0.3
231 0.3
232 0.24
233 0.2
234 0.18
235 0.16
236 0.15
237 0.14
238 0.12
239 0.11
240 0.1
241 0.1
242 0.1
243 0.1
244 0.11
245 0.09
246 0.1
247 0.1
248 0.1
249 0.11
250 0.12
251 0.13
252 0.14
253 0.14
254 0.12
255 0.13
256 0.15
257 0.15
258 0.14
259 0.14
260 0.12
261 0.12
262 0.12
263 0.11
264 0.12
265 0.11
266 0.11
267 0.16
268 0.19
269 0.19
270 0.22
271 0.22
272 0.22
273 0.28
274 0.34
275 0.35
276 0.43
277 0.52
278 0.61
279 0.72
280 0.78
281 0.77
282 0.74
283 0.68
284 0.67
285 0.6
286 0.56
287 0.55
288 0.47
289 0.45
290 0.44
291 0.42
292 0.34
293 0.3
294 0.23
295 0.14
296 0.14
297 0.13
298 0.11
299 0.1
300 0.1
301 0.12
302 0.13
303 0.12
304 0.13