Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V1J3J8

Protein Details
Accession A0A4V1J3J8    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
112-133DIAKRQKKVKPETKLDKVKKALBasic
NLS Segment(s)
PositionSequence
118-121KKVK
Subcellular Location(s) nucl 13, mito 8, cyto 5
Family & Domain DBs
Amino Acid Sequences MAFDHSFNKPNLQIRKASHASCLARKRAARAKMILPQGKYTPLAVRRSTDTQALAVLSGSTGASGPKLTRTVLSGKKARKIERTLRYAAQRKQQKLNAETAAEDGMDVDAEDIAKRQKKVKPETKLDKVKKALWTALENASSETLQATGEGTTLGIQAF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.56
3 0.57
4 0.52
5 0.48
6 0.48
7 0.5
8 0.51
9 0.55
10 0.5
11 0.52
12 0.53
13 0.56
14 0.57
15 0.58
16 0.55
17 0.52
18 0.53
19 0.53
20 0.6
21 0.57
22 0.5
23 0.47
24 0.43
25 0.41
26 0.36
27 0.3
28 0.28
29 0.29
30 0.33
31 0.31
32 0.32
33 0.34
34 0.37
35 0.37
36 0.33
37 0.28
38 0.22
39 0.22
40 0.19
41 0.14
42 0.1
43 0.08
44 0.05
45 0.05
46 0.04
47 0.03
48 0.03
49 0.03
50 0.04
51 0.05
52 0.05
53 0.07
54 0.08
55 0.08
56 0.09
57 0.11
58 0.17
59 0.22
60 0.27
61 0.32
62 0.33
63 0.4
64 0.45
65 0.46
66 0.46
67 0.49
68 0.52
69 0.54
70 0.56
71 0.53
72 0.52
73 0.56
74 0.57
75 0.54
76 0.53
77 0.53
78 0.52
79 0.56
80 0.56
81 0.55
82 0.5
83 0.51
84 0.45
85 0.38
86 0.34
87 0.27
88 0.23
89 0.16
90 0.13
91 0.08
92 0.05
93 0.04
94 0.04
95 0.03
96 0.03
97 0.03
98 0.04
99 0.05
100 0.11
101 0.15
102 0.17
103 0.24
104 0.27
105 0.37
106 0.48
107 0.56
108 0.6
109 0.67
110 0.75
111 0.79
112 0.86
113 0.83
114 0.81
115 0.77
116 0.73
117 0.68
118 0.63
119 0.56
120 0.49
121 0.46
122 0.41
123 0.41
124 0.37
125 0.31
126 0.28
127 0.26
128 0.21
129 0.18
130 0.14
131 0.1
132 0.08
133 0.08
134 0.08
135 0.06
136 0.06
137 0.06
138 0.06
139 0.06