Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9Z826

Protein Details
Accession A0A4P9Z826   
Localization Confidence High
Confidence Score 18.1
NoLS Segment(s)
PositionSequenceProtein Nature
108-133NGDQKPKKSNSSKKGRGKGKSKKKGVBasic
154-183GEDKAAGKKRGKKKAAKRKRRAIEDENDDTBasic
NLS Segment(s)
PositionSequence
112-131KPKKSNSSKKGRGKGKSKKK
158-175AAGKKRGKKKAAKRKRRA
192-207NKKRRGSKAGKAGSKA
Subcellular Location(s) nucl 21, cyto_nucl 12.333, mito_nucl 12.333, mito 2.5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences HPPFPKSELKARADLGETTLLNRLTACLEETKQSIIRLEEKLDEAKGLREEAEMKKAQEQEMLLAERRSREEQMALERVKLQEQATQWAKESRADIVANYSNDYAAENGDQKPKKSNSSKKGRGKGKSKKKGVLNDTDEEASAVETDPELGSDGEDKAAGKKRGKKKAAKRKRRAIEDENDDTADEKLEAANKKRRGSKAGKAGSKAGFKTDESKVDES
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.34
3 0.3
4 0.25
5 0.22
6 0.25
7 0.22
8 0.19
9 0.18
10 0.17
11 0.13
12 0.14
13 0.14
14 0.14
15 0.15
16 0.18
17 0.19
18 0.22
19 0.23
20 0.23
21 0.24
22 0.23
23 0.26
24 0.26
25 0.27
26 0.25
27 0.25
28 0.26
29 0.24
30 0.22
31 0.18
32 0.19
33 0.18
34 0.17
35 0.15
36 0.14
37 0.18
38 0.19
39 0.25
40 0.24
41 0.24
42 0.29
43 0.3
44 0.29
45 0.27
46 0.25
47 0.2
48 0.22
49 0.23
50 0.19
51 0.19
52 0.19
53 0.18
54 0.22
55 0.23
56 0.2
57 0.2
58 0.2
59 0.22
60 0.26
61 0.31
62 0.28
63 0.26
64 0.26
65 0.25
66 0.24
67 0.24
68 0.19
69 0.16
70 0.16
71 0.23
72 0.24
73 0.24
74 0.25
75 0.25
76 0.25
77 0.23
78 0.23
79 0.17
80 0.16
81 0.16
82 0.14
83 0.15
84 0.18
85 0.16
86 0.17
87 0.15
88 0.12
89 0.12
90 0.12
91 0.09
92 0.06
93 0.06
94 0.07
95 0.09
96 0.16
97 0.17
98 0.17
99 0.24
100 0.26
101 0.33
102 0.41
103 0.49
104 0.52
105 0.62
106 0.71
107 0.74
108 0.81
109 0.81
110 0.8
111 0.81
112 0.81
113 0.82
114 0.82
115 0.8
116 0.77
117 0.76
118 0.76
119 0.71
120 0.71
121 0.64
122 0.56
123 0.51
124 0.44
125 0.37
126 0.28
127 0.23
128 0.13
129 0.08
130 0.06
131 0.04
132 0.04
133 0.05
134 0.04
135 0.05
136 0.06
137 0.05
138 0.05
139 0.07
140 0.07
141 0.07
142 0.07
143 0.07
144 0.11
145 0.19
146 0.25
147 0.3
148 0.39
149 0.49
150 0.59
151 0.68
152 0.73
153 0.77
154 0.83
155 0.88
156 0.9
157 0.91
158 0.91
159 0.92
160 0.92
161 0.89
162 0.86
163 0.84
164 0.81
165 0.76
166 0.67
167 0.58
168 0.48
169 0.4
170 0.32
171 0.23
172 0.15
173 0.09
174 0.08
175 0.14
176 0.19
177 0.26
178 0.35
179 0.41
180 0.48
181 0.56
182 0.6
183 0.63
184 0.66
185 0.68
186 0.7
187 0.73
188 0.72
189 0.68
190 0.69
191 0.66
192 0.64
193 0.55
194 0.49
195 0.42
196 0.38
197 0.4
198 0.39
199 0.4