Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9ZE79

Protein Details
Accession A0A4P9ZE79    Localization Confidence Low Confidence Score 7.5
NoLS Segment(s)
PositionSequenceProtein Nature
107-129DDYEIVRVKRKKKDEPVWWHPGSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 7.5, mito 7, cyto_nucl 5.5, plas 4, E.R. 3, golg 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR020164  Cyt_c_Oxase_assmbl_COX16  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
Pfam View protein in Pfam  
PF14138  COX16  
Amino Acid Sequences MYLGSKVFRGKTAQEKYNKTFAGRYMKIMRKNHFLYFGLPFMLSIVAGLVYLQKFTAVKWEKYDEKYQQVSEKEMLSVIKNRRQFDEKKDYYRLQGLLKDHTDEIADDYEIVRVKRKKKDEPVWWHPGS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.61
3 0.63
4 0.68
5 0.63
6 0.55
7 0.5
8 0.48
9 0.5
10 0.43
11 0.45
12 0.46
13 0.51
14 0.57
15 0.61
16 0.6
17 0.58
18 0.61
19 0.57
20 0.52
21 0.47
22 0.41
23 0.37
24 0.32
25 0.24
26 0.2
27 0.17
28 0.13
29 0.12
30 0.08
31 0.05
32 0.04
33 0.03
34 0.03
35 0.03
36 0.05
37 0.04
38 0.05
39 0.05
40 0.06
41 0.06
42 0.06
43 0.16
44 0.18
45 0.19
46 0.22
47 0.27
48 0.3
49 0.33
50 0.39
51 0.33
52 0.34
53 0.35
54 0.34
55 0.35
56 0.32
57 0.31
58 0.27
59 0.24
60 0.18
61 0.17
62 0.16
63 0.13
64 0.18
65 0.21
66 0.25
67 0.3
68 0.31
69 0.35
70 0.4
71 0.43
72 0.45
73 0.52
74 0.51
75 0.52
76 0.57
77 0.55
78 0.53
79 0.53
80 0.46
81 0.38
82 0.38
83 0.34
84 0.33
85 0.33
86 0.32
87 0.27
88 0.25
89 0.22
90 0.18
91 0.18
92 0.13
93 0.12
94 0.1
95 0.1
96 0.12
97 0.14
98 0.14
99 0.21
100 0.26
101 0.34
102 0.44
103 0.52
104 0.6
105 0.69
106 0.79
107 0.81
108 0.85
109 0.86