Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9Z7U8

Protein Details
Accession A0A4P9Z7U8    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
8-42RGRSVRESTKHARRKAPRRRKSRKSDSGRLRPFSYBasic
NLS Segment(s)
PositionSequence
7-34SRGRSVRESTKHARRKAPRRRKSRKSDS
Subcellular Location(s) nucl 19, cyto_nucl 11, mito 7
Family & Domain DBs
Amino Acid Sequences EVVTKPSRGRSVRESTKHARRKAPRRRKSRKSDSGRLRPFSYSTLVNLLESINGTVIGEEFDSLNLPMQEKHLIEKIIDLLSRLTSDMVIDESRYAEGIGRLEKALRVLEGFM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.67
3 0.74
4 0.78
5 0.76
6 0.76
7 0.76
8 0.81
9 0.84
10 0.86
11 0.85
12 0.88
13 0.92
14 0.92
15 0.93
16 0.93
17 0.92
18 0.91
19 0.91
20 0.91
21 0.91
22 0.88
23 0.81
24 0.72
25 0.63
26 0.55
27 0.46
28 0.38
29 0.28
30 0.21
31 0.2
32 0.18
33 0.16
34 0.14
35 0.12
36 0.09
37 0.09
38 0.07
39 0.04
40 0.04
41 0.04
42 0.03
43 0.03
44 0.03
45 0.03
46 0.03
47 0.03
48 0.03
49 0.04
50 0.04
51 0.05
52 0.05
53 0.06
54 0.06
55 0.08
56 0.11
57 0.11
58 0.13
59 0.15
60 0.15
61 0.15
62 0.15
63 0.16
64 0.14
65 0.14
66 0.12
67 0.1
68 0.1
69 0.11
70 0.1
71 0.09
72 0.07
73 0.07
74 0.07
75 0.08
76 0.08
77 0.08
78 0.08
79 0.09
80 0.09
81 0.09
82 0.09
83 0.08
84 0.1
85 0.12
86 0.14
87 0.14
88 0.15
89 0.16
90 0.16
91 0.17
92 0.17
93 0.15