Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9Z8E5

Protein Details
Accession A0A4P9Z8E5    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
6-38ATKTAGSKPKPLRKVTKHKSKTKLRLNSKTARAHydrophilic
NLS Segment(s)
PositionSequence
8-31KTAGSKPKPLRKVTKHKSKTKLRL
Subcellular Location(s) nucl 16, mito 7, cyto 4
Family & Domain DBs
Amino Acid Sequences MAKKTATKTAGSKPKPLRKVTKHKSKTKLRLNSKTARAQTAKLDLDILSVQALHSTLTKVGQAPKTVNTLDAQSLREGLRKDAEMREKNARAEKDLTAQLEFLTGMEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.69
2 0.73
3 0.76
4 0.76
5 0.76
6 0.84
7 0.85
8 0.86
9 0.86
10 0.88
11 0.89
12 0.9
13 0.89
14 0.88
15 0.88
16 0.87
17 0.87
18 0.85
19 0.84
20 0.8
21 0.77
22 0.69
23 0.66
24 0.57
25 0.49
26 0.45
27 0.42
28 0.36
29 0.28
30 0.26
31 0.19
32 0.18
33 0.16
34 0.13
35 0.06
36 0.06
37 0.05
38 0.05
39 0.05
40 0.04
41 0.04
42 0.04
43 0.05
44 0.05
45 0.06
46 0.08
47 0.12
48 0.14
49 0.16
50 0.17
51 0.18
52 0.21
53 0.21
54 0.2
55 0.16
56 0.15
57 0.16
58 0.17
59 0.16
60 0.13
61 0.15
62 0.15
63 0.18
64 0.17
65 0.17
66 0.18
67 0.18
68 0.21
69 0.26
70 0.36
71 0.37
72 0.41
73 0.48
74 0.49
75 0.52
76 0.57
77 0.52
78 0.46
79 0.46
80 0.43
81 0.4
82 0.41
83 0.37
84 0.31
85 0.29
86 0.24
87 0.21
88 0.19