Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4Q0A1X2

Protein Details
Accession A0A4Q0A1X2    Localization Confidence Low Confidence Score 7.3
NoLS Segment(s)
PositionSequenceProtein Nature
343-365ADFPHWHHHHHPHPPPHRPWGCCBasic
NLS Segment(s)
Subcellular Location(s) mito 9, nucl 8, cyto_nucl 8, cyto 6, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR038085  Rnp2-like_sf  
Gene Ontology GO:1902555  C:endoribonuclease complex  
GO:1990904  C:ribonucleoprotein complex  
GO:0004526  F:ribonuclease P activity  
GO:0008033  P:tRNA processing  
CDD cd00298  ACD_sHsps_p23-like  
Amino Acid Sequences MTTTETRKQPFHKTVLRGADWHYFKLQLLTVNGDSTKLSEIDELDFKDAIDYVASNLFGSLQSVDVIDIMSFDPLDTTSIIRCPKSFANKLSGAISISNCVVTFQRNPIFLARIPRTKTMGFPYTDRCFQVWRSRRKGTTSAESSDDKESPELKRIEPIDNNSRIFDHRPRLEGSGHRTDYETDGGPSYGHGHGHHQPHPPPLSHAHTLVDHFESRRQCRHDHPSGSDCSRGCHRSPPPPWAGGGRRWDPSCTREVACHLLTRVMMEVSEEKGRFRLTMRWPPGCEPHRVSYQIDCRHFHVVAVTRSRGHLCEKDVLERTVRLPRGIDVNRATVCFRNGVLVADFPHWHHHHHPHPPPHRPWGCC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.71
3 0.67
4 0.6
5 0.56
6 0.56
7 0.5
8 0.46
9 0.4
10 0.33
11 0.31
12 0.31
13 0.29
14 0.24
15 0.24
16 0.26
17 0.25
18 0.26
19 0.25
20 0.23
21 0.21
22 0.18
23 0.18
24 0.13
25 0.13
26 0.12
27 0.13
28 0.16
29 0.19
30 0.19
31 0.19
32 0.19
33 0.18
34 0.17
35 0.16
36 0.13
37 0.1
38 0.09
39 0.08
40 0.1
41 0.1
42 0.09
43 0.09
44 0.09
45 0.08
46 0.09
47 0.08
48 0.07
49 0.07
50 0.07
51 0.07
52 0.07
53 0.07
54 0.06
55 0.06
56 0.06
57 0.06
58 0.05
59 0.05
60 0.05
61 0.06
62 0.07
63 0.07
64 0.07
65 0.08
66 0.13
67 0.17
68 0.18
69 0.18
70 0.21
71 0.26
72 0.35
73 0.4
74 0.39
75 0.43
76 0.44
77 0.45
78 0.43
79 0.37
80 0.29
81 0.25
82 0.21
83 0.16
84 0.14
85 0.12
86 0.11
87 0.11
88 0.1
89 0.11
90 0.13
91 0.18
92 0.22
93 0.22
94 0.24
95 0.25
96 0.27
97 0.27
98 0.33
99 0.32
100 0.35
101 0.37
102 0.38
103 0.4
104 0.38
105 0.39
106 0.36
107 0.36
108 0.32
109 0.31
110 0.35
111 0.36
112 0.37
113 0.36
114 0.3
115 0.27
116 0.29
117 0.37
118 0.39
119 0.45
120 0.5
121 0.55
122 0.57
123 0.6
124 0.64
125 0.59
126 0.59
127 0.53
128 0.48
129 0.45
130 0.43
131 0.4
132 0.36
133 0.31
134 0.22
135 0.19
136 0.2
137 0.17
138 0.23
139 0.22
140 0.2
141 0.24
142 0.26
143 0.29
144 0.29
145 0.33
146 0.34
147 0.37
148 0.38
149 0.33
150 0.32
151 0.29
152 0.3
153 0.3
154 0.3
155 0.27
156 0.29
157 0.3
158 0.31
159 0.32
160 0.32
161 0.33
162 0.34
163 0.32
164 0.3
165 0.29
166 0.28
167 0.27
168 0.24
169 0.18
170 0.1
171 0.1
172 0.1
173 0.09
174 0.09
175 0.1
176 0.09
177 0.09
178 0.09
179 0.12
180 0.18
181 0.23
182 0.27
183 0.29
184 0.31
185 0.36
186 0.37
187 0.34
188 0.31
189 0.31
190 0.31
191 0.28
192 0.27
193 0.23
194 0.22
195 0.22
196 0.21
197 0.18
198 0.14
199 0.13
200 0.17
201 0.21
202 0.24
203 0.3
204 0.31
205 0.32
206 0.39
207 0.48
208 0.51
209 0.5
210 0.51
211 0.5
212 0.52
213 0.51
214 0.47
215 0.38
216 0.32
217 0.33
218 0.32
219 0.28
220 0.32
221 0.35
222 0.41
223 0.44
224 0.49
225 0.47
226 0.45
227 0.45
228 0.43
229 0.42
230 0.38
231 0.41
232 0.37
233 0.38
234 0.38
235 0.4
236 0.36
237 0.35
238 0.33
239 0.3
240 0.27
241 0.25
242 0.27
243 0.29
244 0.27
245 0.26
246 0.23
247 0.21
248 0.2
249 0.19
250 0.16
251 0.11
252 0.1
253 0.09
254 0.1
255 0.11
256 0.17
257 0.16
258 0.16
259 0.17
260 0.18
261 0.18
262 0.19
263 0.25
264 0.28
265 0.39
266 0.45
267 0.5
268 0.52
269 0.54
270 0.62
271 0.56
272 0.54
273 0.49
274 0.47
275 0.47
276 0.47
277 0.46
278 0.44
279 0.51
280 0.52
281 0.52
282 0.49
283 0.47
284 0.49
285 0.46
286 0.38
287 0.35
288 0.34
289 0.35
290 0.39
291 0.38
292 0.34
293 0.36
294 0.38
295 0.34
296 0.33
297 0.31
298 0.29
299 0.35
300 0.36
301 0.41
302 0.44
303 0.44
304 0.4
305 0.37
306 0.37
307 0.38
308 0.38
309 0.32
310 0.29
311 0.29
312 0.36
313 0.37
314 0.41
315 0.35
316 0.39
317 0.39
318 0.39
319 0.39
320 0.33
321 0.32
322 0.27
323 0.24
324 0.21
325 0.21
326 0.22
327 0.2
328 0.19
329 0.19
330 0.2
331 0.21
332 0.19
333 0.27
334 0.26
335 0.3
336 0.36
337 0.44
338 0.5
339 0.59
340 0.68
341 0.7
342 0.78
343 0.83
344 0.82
345 0.84