Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4V1J4N6

Protein Details
Accession A0A4V1J4N6   
Localization Confidence Medium
Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
16-39FASNAIKRKTKRPAKKQVSEPEVVHydrophilic
NLS Segment(s)
PositionSequence
22-31KRKTKRPAKK
Subcellular Location(s) mito 10, nucl 5, cyto 5, cyto_nucl 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTIPLPAKLRQKNNQFASNAIKRKTKRPAKKQVSEPEVVNNDQEQSEADDLSDDSSSTSATATAAEATTVRQRKAPRSAGLGMGPATQGQGPKINPYLAGFLLVMLVGSILAQIFGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.67
3 0.62
4 0.62
5 0.62
6 0.59
7 0.54
8 0.55
9 0.5
10 0.58
11 0.65
12 0.66
13 0.68
14 0.72
15 0.79
16 0.82
17 0.88
18 0.89
19 0.88
20 0.83
21 0.75
22 0.65
23 0.6
24 0.53
25 0.44
26 0.35
27 0.26
28 0.2
29 0.17
30 0.17
31 0.1
32 0.1
33 0.1
34 0.08
35 0.08
36 0.07
37 0.07
38 0.08
39 0.08
40 0.05
41 0.05
42 0.05
43 0.05
44 0.04
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.04
51 0.04
52 0.04
53 0.04
54 0.05
55 0.12
56 0.14
57 0.15
58 0.18
59 0.22
60 0.28
61 0.37
62 0.41
63 0.38
64 0.41
65 0.42
66 0.41
67 0.38
68 0.33
69 0.25
70 0.2
71 0.17
72 0.11
73 0.1
74 0.09
75 0.09
76 0.09
77 0.13
78 0.14
79 0.18
80 0.2
81 0.2
82 0.2
83 0.21
84 0.23
85 0.18
86 0.19
87 0.14
88 0.12
89 0.11
90 0.1
91 0.08
92 0.05
93 0.05
94 0.03
95 0.03
96 0.03
97 0.03