Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9ZV15

Protein Details
Accession A0A4P9ZV15   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
78-102GGNKLVKGYRQWRDKRKAAKAAGQQHydrophilic
NLS Segment(s)
PositionSequence
93-93R
Subcellular Location(s) extr 16, mito 4, cyto 2, plas 2, E.R. 2, mito_nucl 2
Family & Domain DBs
Amino Acid Sequences MKLLPSLALVLAAIGTVSMVHANPATAEDSAGHQPHLQKRWFRSGLTRVGAGLAGAAAGSALLPGVGTVVGGVAGLYGGNKLVKGYRQWRDKRKAAKAAGQQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.02
4 0.03
5 0.04
6 0.04
7 0.05
8 0.05
9 0.05
10 0.06
11 0.07
12 0.08
13 0.07
14 0.08
15 0.08
16 0.1
17 0.14
18 0.14
19 0.14
20 0.14
21 0.19
22 0.25
23 0.3
24 0.32
25 0.34
26 0.37
27 0.46
28 0.47
29 0.43
30 0.44
31 0.43
32 0.45
33 0.41
34 0.37
35 0.27
36 0.25
37 0.24
38 0.17
39 0.11
40 0.04
41 0.03
42 0.02
43 0.02
44 0.02
45 0.02
46 0.02
47 0.01
48 0.01
49 0.01
50 0.01
51 0.02
52 0.02
53 0.02
54 0.02
55 0.02
56 0.02
57 0.02
58 0.02
59 0.02
60 0.02
61 0.02
62 0.02
63 0.02
64 0.03
65 0.04
66 0.04
67 0.04
68 0.06
69 0.08
70 0.12
71 0.2
72 0.29
73 0.37
74 0.47
75 0.57
76 0.67
77 0.74
78 0.8
79 0.83
80 0.84
81 0.85
82 0.81