Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9ZYI4

Protein Details
Accession A0A4P9ZYI4    Localization Confidence Low Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
91-111EHPPKFKKYDYLRIRNRPFPFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, nucl 2, cyto 2, cyto_nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR001349  Cyt_c_oxidase_su6a  
IPR036418  Cyt_c_oxidase_su6a_sf  
Gene Ontology GO:0005751  C:mitochondrial respiratory chain complex IV  
Pfam View protein in Pfam  
PF02046  COX6A  
Amino Acid Sequences MSLIRFSSRFTAPVRQTVARRSASTATPSPLSGPIKFSPEVKAEMDAVREHGEKTAELWRRISLYGMFPILAVTSYVVYGMAMDHLHHLEEHPPKFKKYDYLRIRNRPFPFGDGDHSLFHNPLVNPDPEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.44
3 0.46
4 0.49
5 0.53
6 0.47
7 0.45
8 0.42
9 0.4
10 0.37
11 0.4
12 0.36
13 0.31
14 0.28
15 0.27
16 0.25
17 0.27
18 0.28
19 0.23
20 0.25
21 0.24
22 0.26
23 0.27
24 0.26
25 0.24
26 0.24
27 0.26
28 0.22
29 0.21
30 0.19
31 0.19
32 0.19
33 0.15
34 0.15
35 0.14
36 0.14
37 0.12
38 0.12
39 0.12
40 0.1
41 0.12
42 0.19
43 0.21
44 0.22
45 0.23
46 0.22
47 0.23
48 0.23
49 0.22
50 0.15
51 0.12
52 0.12
53 0.11
54 0.1
55 0.09
56 0.09
57 0.07
58 0.06
59 0.05
60 0.04
61 0.04
62 0.04
63 0.04
64 0.04
65 0.03
66 0.03
67 0.03
68 0.04
69 0.04
70 0.04
71 0.05
72 0.06
73 0.06
74 0.06
75 0.07
76 0.13
77 0.19
78 0.22
79 0.29
80 0.31
81 0.33
82 0.36
83 0.36
84 0.4
85 0.41
86 0.49
87 0.51
88 0.6
89 0.68
90 0.77
91 0.82
92 0.81
93 0.77
94 0.71
95 0.63
96 0.56
97 0.51
98 0.43
99 0.42
100 0.38
101 0.38
102 0.34
103 0.33
104 0.31
105 0.26
106 0.24
107 0.24
108 0.19
109 0.21
110 0.24