Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9ZKL7

Protein Details
Accession A0A4P9ZKL7   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MTTKRRNHGRNKKGRGRTSYIRCTNHydrophilic
86-110VRSTADSRKRDPPPRFRFKDGKKVLBasic
NLS Segment(s)
PositionSequence
4-16KRRNHGRNKKGRG
94-104KRDPPPRFRFK
Subcellular Location(s) mito 17, cyto 6, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000892  Ribosomal_S26e  
IPR038551  Ribosomal_S26e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01283  Ribosomal_S26e  
PROSITE View protein in PROSITE  
PS00733  RIBOSOMAL_S26E  
Amino Acid Sequences MTTKRRNHGRNKKGRGRTSYIRCTNCARCVPKDKAIKRFTIRNMVESAAIRDMTEASVFEEYAIPKLYIKLQYCVSCAIHSRVVRVRSTADSRKRDPPPRFRFKDGKKVLPTTQKAN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.87
3 0.84
4 0.83
5 0.82
6 0.81
7 0.8
8 0.73
9 0.67
10 0.67
11 0.64
12 0.61
13 0.6
14 0.54
15 0.52
16 0.57
17 0.6
18 0.61
19 0.65
20 0.64
21 0.66
22 0.65
23 0.65
24 0.61
25 0.63
26 0.59
27 0.59
28 0.53
29 0.45
30 0.43
31 0.36
32 0.34
33 0.27
34 0.24
35 0.15
36 0.14
37 0.11
38 0.1
39 0.09
40 0.08
41 0.07
42 0.06
43 0.05
44 0.06
45 0.06
46 0.06
47 0.07
48 0.06
49 0.07
50 0.08
51 0.07
52 0.07
53 0.08
54 0.11
55 0.16
56 0.17
57 0.19
58 0.21
59 0.23
60 0.24
61 0.26
62 0.23
63 0.19
64 0.2
65 0.21
66 0.23
67 0.22
68 0.26
69 0.28
70 0.31
71 0.3
72 0.29
73 0.29
74 0.29
75 0.36
76 0.41
77 0.45
78 0.49
79 0.53
80 0.61
81 0.67
82 0.71
83 0.73
84 0.75
85 0.76
86 0.8
87 0.82
88 0.81
89 0.83
90 0.81
91 0.83
92 0.8
93 0.79
94 0.76
95 0.75
96 0.75
97 0.75