Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9ZTI9

Protein Details
Accession A0A4P9ZTI9   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-59MGRDRSPSSRRERKEHRSHRKDRKRDDRHGHRDRDRSESERHSKDKRRKKDDSPPPAEPBasic
NLS Segment(s)
PositionSequence
7-50PSSRRERKEHRSHRKDRKRDDRHGHRDRDRSESERHSKDKRRKK
Subcellular Location(s) nucl 24, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MGRDRSPSSRRERKEHRSHRKDRKRDDRHGHRDRDRSESERHSKDKRRKKDDSPPPAEPVDLDSFWVEKTPSAPPAPTEPSAQVVTLPNFDDQGRPLNLDQEPLLQHLKAGTSETKAQRRRPVSVLDEGKDTDIMTMLHQEKYANSQSTDRQMAKRILRDAKFKASGGN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.88
3 0.88
4 0.89
5 0.93
6 0.95
7 0.95
8 0.95
9 0.94
10 0.94
11 0.93
12 0.93
13 0.93
14 0.93
15 0.93
16 0.92
17 0.91
18 0.88
19 0.87
20 0.79
21 0.76
22 0.7
23 0.63
24 0.6
25 0.6
26 0.6
27 0.59
28 0.62
29 0.63
30 0.68
31 0.74
32 0.78
33 0.79
34 0.79
35 0.8
36 0.83
37 0.85
38 0.85
39 0.86
40 0.83
41 0.76
42 0.7
43 0.62
44 0.53
45 0.42
46 0.35
47 0.28
48 0.2
49 0.17
50 0.13
51 0.13
52 0.13
53 0.14
54 0.09
55 0.06
56 0.08
57 0.09
58 0.12
59 0.13
60 0.13
61 0.13
62 0.18
63 0.21
64 0.2
65 0.2
66 0.18
67 0.19
68 0.2
69 0.18
70 0.15
71 0.13
72 0.12
73 0.12
74 0.12
75 0.09
76 0.1
77 0.1
78 0.1
79 0.09
80 0.13
81 0.12
82 0.13
83 0.13
84 0.16
85 0.16
86 0.17
87 0.16
88 0.14
89 0.14
90 0.15
91 0.16
92 0.11
93 0.11
94 0.11
95 0.11
96 0.09
97 0.11
98 0.1
99 0.12
100 0.19
101 0.25
102 0.33
103 0.39
104 0.45
105 0.51
106 0.54
107 0.56
108 0.53
109 0.53
110 0.49
111 0.52
112 0.51
113 0.44
114 0.41
115 0.37
116 0.34
117 0.28
118 0.23
119 0.14
120 0.1
121 0.09
122 0.08
123 0.14
124 0.15
125 0.16
126 0.16
127 0.17
128 0.17
129 0.22
130 0.28
131 0.24
132 0.24
133 0.27
134 0.31
135 0.38
136 0.44
137 0.42
138 0.39
139 0.42
140 0.49
141 0.52
142 0.54
143 0.55
144 0.58
145 0.59
146 0.64
147 0.63
148 0.64
149 0.62