Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9ZMU3

Protein Details
Accession A0A4P9ZMU3    Localization Confidence Low Confidence Score 6.7
NoLS Segment(s)
PositionSequenceProtein Nature
9-28LSSRKFKTVKTNSKLYKRGKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15.5, mito_nucl 11.833, nucl 7, cyto_nucl 6.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR046950  DNA-dir_Rpol_C_phage-type  
IPR002092  DNA-dir_Rpol_phage-type  
IPR043502  DNA/RNA_pol_sf  
Gene Ontology GO:0000428  C:DNA-directed RNA polymerase complex  
GO:0003677  F:DNA binding  
GO:0003899  F:DNA-directed 5'-3' RNA polymerase activity  
GO:0006351  P:DNA-templated transcription  
Pfam View protein in Pfam  
PF00940  RNA_pol  
Amino Acid Sequences TPSNMLVSLSSRKFKTVKTNSKLYKRGKSISISLPLNEYNFNIIKRGFMPNFIHSMDAANIHLLINLILSDKDLSLYTIHDCFASTPNNMGKINKFVRNTFIKLYFDKNYLNIMHNNFIEQIKCHYTVYDNDNIKYFYIDDELVIIPNLPSSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.47
3 0.51
4 0.57
5 0.57
6 0.67
7 0.71
8 0.78
9 0.83
10 0.8
11 0.78
12 0.74
13 0.73
14 0.68
15 0.63
16 0.59
17 0.56
18 0.55
19 0.47
20 0.4
21 0.38
22 0.34
23 0.31
24 0.26
25 0.2
26 0.17
27 0.18
28 0.17
29 0.17
30 0.16
31 0.16
32 0.17
33 0.24
34 0.2
35 0.23
36 0.26
37 0.26
38 0.29
39 0.28
40 0.26
41 0.19
42 0.2
43 0.15
44 0.13
45 0.11
46 0.08
47 0.08
48 0.07
49 0.07
50 0.06
51 0.05
52 0.04
53 0.04
54 0.04
55 0.04
56 0.04
57 0.04
58 0.04
59 0.05
60 0.05
61 0.06
62 0.05
63 0.06
64 0.07
65 0.08
66 0.08
67 0.07
68 0.07
69 0.08
70 0.1
71 0.11
72 0.1
73 0.12
74 0.14
75 0.17
76 0.18
77 0.18
78 0.17
79 0.23
80 0.27
81 0.3
82 0.31
83 0.29
84 0.34
85 0.38
86 0.39
87 0.35
88 0.34
89 0.31
90 0.31
91 0.36
92 0.32
93 0.3
94 0.28
95 0.25
96 0.25
97 0.24
98 0.25
99 0.25
100 0.25
101 0.26
102 0.25
103 0.25
104 0.23
105 0.22
106 0.2
107 0.17
108 0.19
109 0.19
110 0.21
111 0.2
112 0.19
113 0.21
114 0.25
115 0.29
116 0.33
117 0.32
118 0.32
119 0.34
120 0.34
121 0.32
122 0.28
123 0.23
124 0.16
125 0.16
126 0.15
127 0.12
128 0.14
129 0.14
130 0.13
131 0.13
132 0.12
133 0.08