Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9ZMM3

Protein Details
Accession A0A4P9ZMM3    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
65-90HNDFMRRVNMKKEKKRLERQKARDELBasic
NLS Segment(s)
PositionSequence
75-86KKEKKRLERQKA
Subcellular Location(s) nucl 18, cyto 6, mito 3, cyto_pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR008698  NDUB7  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0005758  C:mitochondrial intermembrane space  
GO:0070469  C:respirasome  
Pfam View protein in Pfam  
PF05676  NDUF_B7  
Amino Acid Sequences MLAEDPFKEPEMKMTQRQLAEYRIPLEVRDYCAHLLVPLNRCRYDNFFLAWTCKHEKHEYELCQHNDFMRRVNMKKEKKRLERQKARDEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.45
3 0.45
4 0.48
5 0.44
6 0.4
7 0.39
8 0.35
9 0.3
10 0.27
11 0.26
12 0.23
13 0.24
14 0.21
15 0.21
16 0.21
17 0.21
18 0.19
19 0.19
20 0.19
21 0.15
22 0.17
23 0.17
24 0.21
25 0.24
26 0.27
27 0.27
28 0.28
29 0.3
30 0.32
31 0.31
32 0.26
33 0.22
34 0.21
35 0.21
36 0.22
37 0.21
38 0.2
39 0.21
40 0.22
41 0.25
42 0.27
43 0.28
44 0.33
45 0.41
46 0.4
47 0.42
48 0.48
49 0.47
50 0.44
51 0.43
52 0.4
53 0.38
54 0.36
55 0.33
56 0.33
57 0.37
58 0.38
59 0.47
60 0.55
61 0.59
62 0.68
63 0.75
64 0.78
65 0.82
66 0.9
67 0.91
68 0.92
69 0.93
70 0.93