Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4Q0A0R0

Protein Details
Accession A0A4Q0A0R0    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
89-115SSPITVVKFKKRKDYKKTIVYQHKYTLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 12, cyto_nucl 9, nucl 7.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036164  L21-like_sf  
IPR028909  L21p-like  
IPR001787  Ribosomal_L21  
Gene Ontology GO:0005737  C:cytoplasm  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00829  Ribosomal_L21p  
Amino Acid Sequences FGPDTKALVNRLRNQINYFATVRIKGRLFTVTEGDMIVTERMADLALGDVLQLDRVKEIGSRDFSIVGKPYVSPEYYTIRAVVMEHTLSSPITVVKFKKRKDYKKTIVYQHKYTLLRVSKLDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.53
2 0.56
3 0.51
4 0.47
5 0.41
6 0.36
7 0.33
8 0.33
9 0.31
10 0.29
11 0.28
12 0.24
13 0.25
14 0.24
15 0.24
16 0.23
17 0.24
18 0.19
19 0.18
20 0.18
21 0.15
22 0.12
23 0.11
24 0.09
25 0.06
26 0.05
27 0.05
28 0.05
29 0.04
30 0.04
31 0.03
32 0.03
33 0.03
34 0.03
35 0.03
36 0.03
37 0.03
38 0.05
39 0.05
40 0.04
41 0.05
42 0.05
43 0.05
44 0.07
45 0.08
46 0.11
47 0.13
48 0.14
49 0.14
50 0.16
51 0.16
52 0.16
53 0.15
54 0.12
55 0.1
56 0.09
57 0.11
58 0.11
59 0.12
60 0.11
61 0.13
62 0.17
63 0.18
64 0.19
65 0.17
66 0.15
67 0.15
68 0.14
69 0.12
70 0.1
71 0.08
72 0.08
73 0.08
74 0.09
75 0.08
76 0.08
77 0.08
78 0.07
79 0.09
80 0.13
81 0.16
82 0.26
83 0.34
84 0.38
85 0.48
86 0.58
87 0.67
88 0.73
89 0.81
90 0.8
91 0.83
92 0.88
93 0.88
94 0.88
95 0.85
96 0.8
97 0.75
98 0.73
99 0.65
100 0.58
101 0.57
102 0.52
103 0.48