Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9ZU60

Protein Details
Accession A0A4P9ZU60    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
142-164HLPKNIAKPSKLRRNQRRLTLISHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 27
Family & Domain DBs
Amino Acid Sequences VLPPVLNDSAPNLPLPDSGPDAVKRRSQSMDGSRHPRALRRSQSLETMLKPIETHLQSPQLLPPSPSAFSRPLFNLGGLSQRSPLAPKSEIAAPSTASSVSSTLPDKSRMFSQRSPSGDGGSLYPRPVDKGRFPPQDQLQSHLPKNIAKPSKLRRNQRRLTLISIPPSGQPALTPGPGPGSSPSSPSLFVTLAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.18
3 0.17
4 0.17
5 0.17
6 0.2
7 0.24
8 0.29
9 0.31
10 0.35
11 0.35
12 0.36
13 0.39
14 0.38
15 0.42
16 0.46
17 0.52
18 0.54
19 0.59
20 0.57
21 0.6
22 0.58
23 0.56
24 0.54
25 0.55
26 0.56
27 0.56
28 0.6
29 0.56
30 0.59
31 0.58
32 0.53
33 0.45
34 0.4
35 0.32
36 0.26
37 0.24
38 0.2
39 0.22
40 0.2
41 0.2
42 0.2
43 0.24
44 0.24
45 0.25
46 0.27
47 0.23
48 0.23
49 0.22
50 0.22
51 0.2
52 0.21
53 0.21
54 0.21
55 0.2
56 0.2
57 0.22
58 0.2
59 0.21
60 0.21
61 0.2
62 0.17
63 0.15
64 0.18
65 0.16
66 0.16
67 0.12
68 0.12
69 0.12
70 0.13
71 0.14
72 0.13
73 0.13
74 0.13
75 0.14
76 0.17
77 0.17
78 0.17
79 0.16
80 0.13
81 0.12
82 0.13
83 0.1
84 0.07
85 0.07
86 0.07
87 0.06
88 0.07
89 0.08
90 0.09
91 0.11
92 0.15
93 0.15
94 0.16
95 0.22
96 0.25
97 0.3
98 0.32
99 0.38
100 0.4
101 0.42
102 0.45
103 0.4
104 0.36
105 0.31
106 0.28
107 0.23
108 0.19
109 0.18
110 0.13
111 0.14
112 0.12
113 0.15
114 0.17
115 0.2
116 0.23
117 0.31
118 0.41
119 0.48
120 0.5
121 0.54
122 0.57
123 0.63
124 0.57
125 0.53
126 0.51
127 0.49
128 0.49
129 0.44
130 0.4
131 0.33
132 0.37
133 0.41
134 0.39
135 0.37
136 0.45
137 0.51
138 0.61
139 0.66
140 0.74
141 0.75
142 0.8
143 0.85
144 0.86
145 0.84
146 0.77
147 0.75
148 0.73
149 0.67
150 0.61
151 0.55
152 0.46
153 0.38
154 0.37
155 0.3
156 0.21
157 0.17
158 0.16
159 0.17
160 0.17
161 0.17
162 0.15
163 0.19
164 0.19
165 0.2
166 0.19
167 0.22
168 0.21
169 0.24
170 0.26
171 0.24
172 0.25
173 0.24
174 0.25