Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A4P9ZVI3

Protein Details
Accession A0A4P9ZVI3    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MAPRVTYRRRKTFQTKSNRVKKVKTPGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, mito 10, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR008195  Ribosomal_L34Ae  
IPR018065  Ribosomal_L34e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01199  Ribosomal_L34e  
PROSITE View protein in PROSITE  
PS01145  RIBOSOMAL_L34E  
Amino Acid Sequences MAPRVTYRRRKTFQTKSNRVKKVKTPGGRLVFQYVNKPAKGPHCGDCNIRLSGTPALRPREYARLSHCKKSVSRAYGGSRCANCVRTRIVRAFLIEEQKIVKKVLKSSGRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.84
3 0.84
4 0.9
5 0.9
6 0.85
7 0.81
8 0.8
9 0.8
10 0.79
11 0.76
12 0.73
13 0.72
14 0.72
15 0.67
16 0.6
17 0.54
18 0.48
19 0.42
20 0.39
21 0.37
22 0.35
23 0.33
24 0.32
25 0.3
26 0.31
27 0.35
28 0.33
29 0.31
30 0.31
31 0.33
32 0.35
33 0.35
34 0.33
35 0.29
36 0.26
37 0.21
38 0.19
39 0.21
40 0.2
41 0.2
42 0.2
43 0.23
44 0.23
45 0.25
46 0.25
47 0.29
48 0.3
49 0.29
50 0.32
51 0.39
52 0.43
53 0.47
54 0.48
55 0.44
56 0.43
57 0.49
58 0.5
59 0.43
60 0.42
61 0.41
62 0.46
63 0.46
64 0.48
65 0.46
66 0.39
67 0.39
68 0.38
69 0.37
70 0.31
71 0.31
72 0.33
73 0.33
74 0.38
75 0.38
76 0.39
77 0.38
78 0.38
79 0.39
80 0.37
81 0.37
82 0.32
83 0.3
84 0.29
85 0.31
86 0.31
87 0.29
88 0.29
89 0.26
90 0.32
91 0.4