Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A4P9ZVB4

Protein Details
Accession A0A4P9ZVB4    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
27-55AELADPAKKRRPRRPKDPNAPKKPQNAYFHydrophilic
NLS Segment(s)
PositionSequence
33-49AKKRRPRRPKDPNAPKK
Subcellular Location(s) nucl 19, cyto_nucl 13.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd22012  HMG-box_ABF2_IXR1-like_rpt2  
Amino Acid Sequences MDEAGGGSSQSASTQLGMAPEGSDPDAELADPAKKRRPRRPKDPNAPKKPQNAYFRYRDQELGRMKTDNETETITDLTRRISENWKNLSTKDKQPFFDQYNREIDVYRVIYKEYRLAMKARAEALGETPDPSLLDPPVINPADPNDPVQLDEEDEQEVHLLLDSDPVENA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.09
3 0.09
4 0.1
5 0.1
6 0.09
7 0.09
8 0.1
9 0.1
10 0.08
11 0.08
12 0.08
13 0.08
14 0.07
15 0.08
16 0.08
17 0.12
18 0.16
19 0.19
20 0.28
21 0.35
22 0.44
23 0.55
24 0.65
25 0.69
26 0.78
27 0.85
28 0.88
29 0.92
30 0.94
31 0.95
32 0.93
33 0.93
34 0.88
35 0.86
36 0.82
37 0.79
38 0.77
39 0.72
40 0.68
41 0.65
42 0.64
43 0.59
44 0.53
45 0.49
46 0.41
47 0.42
48 0.42
49 0.39
50 0.35
51 0.32
52 0.31
53 0.3
54 0.3
55 0.23
56 0.18
57 0.15
58 0.14
59 0.14
60 0.14
61 0.11
62 0.1
63 0.1
64 0.09
65 0.09
66 0.1
67 0.11
68 0.19
69 0.24
70 0.3
71 0.34
72 0.36
73 0.36
74 0.36
75 0.4
76 0.36
77 0.39
78 0.41
79 0.41
80 0.39
81 0.42
82 0.46
83 0.45
84 0.48
85 0.42
86 0.38
87 0.38
88 0.37
89 0.34
90 0.29
91 0.25
92 0.22
93 0.21
94 0.19
95 0.16
96 0.15
97 0.16
98 0.17
99 0.2
100 0.18
101 0.18
102 0.18
103 0.2
104 0.23
105 0.25
106 0.27
107 0.24
108 0.23
109 0.21
110 0.19
111 0.19
112 0.18
113 0.14
114 0.13
115 0.12
116 0.11
117 0.11
118 0.11
119 0.11
120 0.08
121 0.09
122 0.09
123 0.09
124 0.16
125 0.16
126 0.16
127 0.15
128 0.18
129 0.21
130 0.22
131 0.23
132 0.19
133 0.19
134 0.2
135 0.22
136 0.19
137 0.17
138 0.17
139 0.16
140 0.15
141 0.15
142 0.14
143 0.12
144 0.11
145 0.08
146 0.08
147 0.08
148 0.06
149 0.1
150 0.11